StarFunc result for job id Q14694

User Input

>input (798 residues)
MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQRIEFG
VDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQYPGS
ALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGH
ANSAVPNSVSAEDAEFMGDMPPSVTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDTRTAG
QPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATN
GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSPVAYV
ETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRGLINK
GNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMPVPPK
PRQALGDKIVRDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEML
NLKKLLSPSNEKLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQT
PITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYT
TKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPG
VKNKNFKCHRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVK
PTAERTAYLLYYRRVDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14694	1.000	1.000	0.000	798	1.000	1.000	Q14694.pdb.gz	UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2
2	AFDB:Q9W0L7	0.437	0.235	3.016E-45	1517	0.291	0.153	Q9W0L7.pdb.gz	Q9W0L7_DROME LD28815p OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=2
3	PDB:5cvnB	0.327	0.775	1.373E-23	321	0.104	0.259	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
4	PDB:5k16B	0.322	0.741	2.774E-22	328	0.103	0.250	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
5	PDB:3mhsA	0.329	0.560	6.137E-22	455	0.110	0.193	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
6	PDB:7w3ax	0.329	0.516	2.137E-21	494	0.102	0.164	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
7	PDB:7ay1D	0.334	0.738	4.838E-20	341	0.104	0.243	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
8	PDB:5gjqx	0.326	0.695	1.199E-19	355	0.089	0.200	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
9	PDB:7yxxA	0.313	0.149	1.421E-19	1754	0.108	0.049	7yxxA.pdb.gz
10	PDB:8a9kD	0.304	0.805	2.163E-18	285	0.098	0.274	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
11	PDB:4wa6D	0.293	0.540	2.872E-18	415	0.112	0.214	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
12	PDB:3ihpB	0.315	0.365	5.673E-18	681	0.093	0.109	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
13	AFDB:Q9H9J4	0.340	0.210	1.252E-14	1324	0.142	0.085	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
14	AFDB:A0A024R8V6	0.346	0.250	4.830E-12	1123	0.139	0.099	A0A024R8V6.pdb.gz
15	AFDB:E7F4C0	0.347	0.254	4.830E-12	1104	0.125	0.091	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
16	AFDB:B1AQJ2	0.347	0.257	8.048E-12	1098	0.132	0.096	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
17	AFDB:B7Z0K1	0.059	0.045	1.888E-1	1137	0.145	0.102	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
18	AFDB:Q9Y7U6	0.052	0.035	4.678E-1	1334	0.103	0.061	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
19	AFDB:Q8NDZ0	0.064	0.064	6.575E-1	799	0.118	0.118	Q8NDZ0.pdb.gz	BEND2_HUMAN BEN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BEND2 PE=1 SV=2
20	AFDB:Q9SZW3	0.063	0.044	7.794E-1	1311	0.090	0.055	Q9SZW3.pdb.gz	Q9SZW3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g30100 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14694	0.0	1643	798	1.000	1.000	UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2
2	M9PDK3	7.54e-93	310	797	0.232	0.232	M9PDK3_DROME Ubiquitin specific protease 10, isoform B OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=1
3	Q9W0L7	3.03e-89	310	1517	0.229	0.121	Q9W0L7_DROME LD28815p OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=2
4	O94269	1.25e-70	243	512	0.208	0.324	UBP3_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp3 PE=3 SV=1
5	O96612	9.26e-44	166	451	0.128	0.226	UBPB_DICDI Ubiquitin hydrolase B OS=Dictyostelium discoideum OX=44689 GN=ubpB PE=1 SV=1
6	Q01477	1.12e-41	166	912	0.168	0.147	UBP3_YEAST Ubiquitin carboxyl-terminal hydrolase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP3 PE=1 SV=1
7	Q6QN14	1.15e-20	97.4	398	0.157	0.314	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
8	Q0WX57	2.35e-20	97.8	530	0.155	0.234	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
9	Q6R6M4	4.10e-20	97.1	530	0.158	0.238	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
10	Q80U87	4.68e-20	98.2	1080	0.147	0.108	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
11	D3ZN39	5.61e-20	97.8	1081	0.124	0.092	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
12	O74442	7.92e-20	95.5	457	0.137	0.239	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
13	P40818	2.48e-19	95.9	1118	0.125	0.089	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
14	P38187	3.26e-19	95.1	747	0.091	0.098	UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP13 PE=1 SV=3
15	Q6P8X6	1.39e-18	90.9	390	0.125	0.256	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
16	Q9H9J4	1.50e-18	93.6	1324	0.120	0.073	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
17	B2RQC2	1.65e-18	93.6	1324	0.120	0.073	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
18	E9Q9U0	2.43e-18	91.3	468	0.124	0.212	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
19	Q381Y9	4.96e-18	89.7	442	0.124	0.224	Q381Y9_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6080 PE=4 SV=1
20	Q9FIQ1	1.05e-17	90.1	732	0.127	0.138	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07145 PAM2	0.23	22.3	Ataxin-2 C-terminal region
2	PF00443 UCH	1.2e-41	154.6	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	0.0066	27.7	Ubiquitin carboxyl-terminal hydrolase
4	PF08817 YukD	1e+02	15.1	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012475

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000018009	0.958	G3BP stress granule assembly factor 1
2	9593.ENSGGOP00000014586	0.946	G3BP stress granule assembly factor 2
3	9593.ENSGGOP00000009561	0.875	Cellular tumor antigen p53
4	9593.ENSGGOP00000013587	0.850	Eukaryotic translation initiation factor 4 gamma, 1
5	9593.ENSGGOP00000000316	0.823	Thyroid hormone receptor interactor 12
6	9593.ENSGGOP00000017507	0.797	Uncharacterized protein
7	9593.ENSGGOP00000023428	0.797	Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane (By similarity). Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO(3-)
8	9593.ENSGGOP00000028581	0.786	Ubiquitinyl hydrolase 1
9	9593.ENSGGOP00000015621	0.771	Ubiquitin specific peptidase 50
10	9593.ENSGGOP00000004251	0.758	Ubiquitin specific peptidase 24
11	9593.ENSGGOP00000028000	0.757	Sorting nexin 3
12	9593.ENSGGOP00000014450	0.737	DNA-directed RNA polymerase subunit
13	9593.ENSGGOP00000002580	0.723	Ubiquitinyl hydrolase 1
14	9593.ENSGGOP00000001565	0.689	Beclin 1, autophagy related
15	9593.ENSGGOP00000001644	0.689	SH3-domain binding protein 5 (BTK-associated)
16	9593.ENSGGOP00000014995	0.671	Ubiquitin specific peptidase 42
17	9593.ENSGGOP00000014398	0.669	UBX domain protein 7
18	9593.ENSGGOP00000001523	0.654	Ubiquitin specific peptidase 25
19	9593.ENSGGOP00000005022	0.654	Ubiquitin specific peptidase 28
20	9593.ENSGGOP00000006281	0.652	Ubiquitin specific peptidase 43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:0002039	1.000	p53 binding
GO:0003723	1.000	RNA binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.999	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:0090304	0.967	nucleic acid metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0070646	0.955	protein modification by small protein removal
GO:0016579	0.949	protein deubiquitination
GO:0048519	0.947	negative regulation of biological process
GO:0006974	0.942	cellular response to DNA damage stimulus
GO:0048523	0.941	negative regulation of cellular process
GO:0006281	0.932	DNA repair
GO:0009966	0.903	regulation of signal transduction
GO:0007154	0.891	cell communication
GO:0023052	0.889	signaling
GO:0009894	0.887	regulation of catabolic process
GO:0044249	0.887	cellular biosynthetic process
GO:0044271	0.879	cellular nitrogen compound biosynthetic process
GO:0006301	0.819	postreplication repair
GO:0007165	0.809	signal transduction
GO:0000731	0.809	DNA synthesis involved in DNA repair
GO:1902531	0.797	regulation of intracellular signal transduction
GO:0043122	0.713	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0042221	0.707	response to chemical
GO:0035556	0.566	intracellular signal transduction
GO:0060255	0.565	regulation of macromolecule metabolic process
GO:0023057	0.563	negative regulation of signaling
GO:0010033	0.535	response to organic substance
GO:0051171	0.532	regulation of nitrogen compound metabolic process
GO:0080090	0.531	regulation of primary metabolic process
GO:0048585	0.488	negative regulation of response to stimulus
GO:0009968	0.460	negative regulation of signal transduction
GO:0072331	0.449	signal transduction by p53 class mediator
GO:0031329	0.441	regulation of cellular catabolic process
GO:0019985	0.335	translesion synthesis
GO:0048518	0.332	positive regulation of biological process
GO:0071310	0.311	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031982	0.983	vesicle
GO:0031410	0.801	cytoplasmic vesicle
GO:0005768	0.750	endosome
GO:0005856	0.666	cytoskeleton
GO:0005769	0.453	early endosome
GO:0045111	0.380	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.999	Cysteine endopeptidases.

[back to server]