StarFunc result for job id Q14699

User Input

>input (578 residues)
MGCGLNKLEKRDEKRPGNIYSTLKRPQVETKIDVSYEYRFLEFTTLSAAELPGSSAVRLA
SLRDLPAQLLELYQQGFSLAALHPFVQPTHEREKTPLEHIFRAILIKKTDRSQKTDLHNE
GYILELDCCSSLDHPTDQKLIPEFIKKIQEAASQGLKFVGVIPQYHSSVNSAGSSAPVST
ANSTEDARDAKNARGDHASLENEKPGTGDVCSAPAGRNQSPEPSSGPRGEVPLAKQPSSP
SGEGDGGELSPQGVSKTLDGPESNPLEVHEEPLSGKMEIFTLFNKPKSHQKCRQYYPVTI
PLHVSKNGQTVSGLDANWLEHMSDHFRKGGMLVNAVFYLGIVNDSLHGLTDGVFIFEAVS
TEDSKTIQGYDAIVVEQWTVLEGVEVQTDYVPLLNSLAAYGWQLTCVLPTPVVKTTSEGS
VSTKQIVFLQRPCLPQKIKKKESKFQWRFSREEMHNRQMRKSKGKLSARDKQQAEENEKN
LEDQSSKAGDMGNCVSGQQQEGGVSEEMKGPVQEDKGEQLSPGGLLCGVGVEGEAVQNGP
ASHSRALVGICTGHSNPGEDARDGDAEEVRELGTVEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14699	1.000	1.000	6.535E-96	578	1.000	1.000	Q14699.pdb.gz	RFTN1_HUMAN Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4
2	AFDB:Q6A0D4	0.613	0.639	3.422E-68	554	0.689	0.718	Q6A0D4.pdb.gz	RFTN1_MOUSE Raftlin OS=Mus musculus OX=10090 GN=Rftn1 PE=1 SV=4
3	AFDB:Q8CHX7	0.524	0.603	5.090E-35	500	0.265	0.306	Q8CHX7.pdb.gz	RFTN2_MOUSE Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3
4	AFDB:E9QHV7	0.068	0.036	4.141E-2	1342	0.092	0.039	E9QHV7.pdb.gz
5	AFDB:Q389I1	0.101	0.098	7.996E-2	599	0.114	0.110	Q389I1.pdb.gz	Q389I1_TRYB2 RNA-binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0310 PE=4 SV=1
6	PDB:1ngwH	0.051	0.102	1.706E-1	216	0.036	0.097	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
7	PDB:7qpdT	0.048	0.069	2.504E-1	348	0.038	0.063	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
8	PDB:1cjyA	0.076	0.071	4.101E-1	633	0.017	0.016	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
9	PDB:6enyC	0.052	0.074	6.020E-1	364	0.048	0.077	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
10	PDB:1d5yA	0.074	0.120	6.359E-1	288	0.033	0.066	1d5yA.pdb.gz	Crystal structure of the Escherichia coli Rob transcription factor in complex with DNA.
11	AFDB:A0A087WT53	0.072	0.043	8.927E-1	1155	0.118	0.059	A0A087WT53.pdb.gz	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
12	PDB:7mjpA	0.051	0.074	9.861E-1	366	0.021	0.033	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
13	PDB:6bm7E	0.055	0.086	1.042	291	0.033	0.065	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
14	AFDB:D3YXK1	0.061	0.066	1.052	519	0.111	0.123	D3YXK1.pdb.gz	SAMD1_MOUSE Sterile alpha motif domain-containing protein 1 OS=Mus musculus OX=10090 GN=Samd1 PE=1 SV=1
15	AFDB:Q09459	0.069	0.041	1.112	1322	0.066	0.029	Q09459.pdb.gz	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4
16	PDB:6ahrL	0.083	0.116	1.162	362	0.026	0.041	6ahrL.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
17	PDB:7akjA	0.056	0.036	1.162	1084	0.026	0.014	7akjA.pdb.gz
18	AFDB:Q99MQ1	0.073	0.054	1.310	977	0.111	0.066	Q99MQ1.pdb.gz	BICC1_MOUSE Protein bicaudal C homolog 1 OS=Mus musculus OX=10090 GN=Bicc1 PE=1 SV=1
19	AFDB:Q99MR9	0.059	0.038	1.310	1089	0.097	0.051	Q99MR9.pdb.gz	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
20	PDB:4a2bA	0.084	0.114	1.706	386	0.028	0.041	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14699	0.0	1193	578	1.000	1.000	RFTN1_HUMAN Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4
2	Q6A0D4	0.0	785	554	0.687	0.717	RFTN1_MOUSE Raftlin OS=Mus musculus OX=10090 GN=Rftn1 PE=1 SV=4
3	Q52LD8	6.48e-69	233	501	0.279	0.321	RFTN2_HUMAN Raftlin-2 OS=Homo sapiens OX=9606 GN=RFTN2 PE=1 SV=3
4	Q8CHX7	8.95e-67	227	500	0.268	0.310	RFTN2_MOUSE Raftlin-2 OS=Mus musculus OX=10090 GN=Rftn2 PE=1 SV=3
5	Q18240	0.35	35.8	312	0.038	0.071	SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=2 SV=2
6	Q7JMA9	0.35	35.8	313	0.038	0.070	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
7	P32166	0.56	35.0	308	0.038	0.071	MENA_ECOLI 1,4-dihydroxy-2-naphthoate octaprenyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=menA PE=1 SV=1
8	O86314	0.90	33.9	180	0.038	0.122	O86314_MYCTU Probable membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1231c PE=1 SV=1
9	Q5BE39	1.9	31.6	94	0.028	0.170	Q5BE39_EMENI Ubiquitin-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sumO PE=4 SV=1
10	Q7ZVQ7	2.2	33.9	654	0.031	0.028	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
11	Q582C5	2.8	33.5	986	0.054	0.031	Q582C5_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.500 PE=4 SV=1
12	Q9C093	4.0	33.1	1822	0.054	0.017	SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens OX=9606 GN=SPEF2 PE=1 SV=2
13	O44956	5.9	30.8	135	0.040	0.170	O44956_CAEEL KNL (Kinetochore null) Binding Protein OS=Caenorhabditis elegans OX=6239 GN=kbp-5 PE=1 SV=1
14	P39113	7.1	32.3	1433	0.036	0.015	CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAT8 PE=1 SV=2
15	Q3UGZ4	8.4	32.0	2388	0.054	0.013	Q3UGZ4_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
16	Q68FG2	8.5	32.0	2388	0.054	0.013	Q68FG2_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=1 SV=1
17	Q6A087	9.4	32.0	1972	0.054	0.016	Q6A087_MOUSE MKIAA0302 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13783 DUF4177	26	16.5	Domain of unknown function (DUF4177)
2	PF15250 Raftlin	1.7e-233	787.0	Raftlin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345133	0.709	Serine/threonine-protein kinase MRCK gamma
2	9606.ENSP00000356437	0.676	SAM and SH3 domain-containing protein 1
3	9606.ENSP00000285083	0.661	Oxidoreductase NAD-binding domain-containing protein 1
4	9606.ENSP00000443021	0.656	Ras association domain family member 3
5	9606.ENSP00000344260	0.640	Polypeptide N-acetylgalactosaminyltransferase 15
6	9606.ENSP00000361186	0.636	TP53-regulating kinase
7	9606.ENSP00000386532	0.595	Ankyrin repeat and SOCS box protein 18
8	9606.ENSP00000272732	0.590	Secernin-3
9	9606.ENSP00000290155	0.586	UPF0769 protein C21orf59
10	9606.ENSP00000264990	0.565	Acyl-CoA dehydrogenase family member 11
11	9606.ENSP00000419599	0.556	DPH3 homolog
12	9606.ENSP00000227756	0.538	Polypeptide N-acetylgalactosaminyltransferase 18
13	9606.ENSP00000353270	0.535	Endoplasmic reticulum-Golgi intermediate compartment protein 2
14	9606.ENSP00000479207	0.526	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5
15	9606.ENSP00000360366	0.520	Acyl-coenzyme A thioesterase 11
16	9606.ENSP00000366475	0.514	Autophagy-related protein 2 homolog A
17	9606.ENSP00000324701	0.513	Protein mab-21-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003725	1.000	double-stranded RNA binding
GO:0005515	0.447	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0048518	0.956	positive regulation of biological process
GO:0048583	0.905	regulation of response to stimulus
GO:0050896	0.901	response to stimulus
GO:0043331	0.889	response to dsRNA
GO:0050657	0.886	nucleic acid transport
GO:0050658	0.881	RNA transport
GO:0043330	0.830	response to exogenous dsRNA
GO:0048584	0.802	positive regulation of response to stimulus
GO:0002376	0.788	immune system process
GO:0007165	0.785	signal transduction
GO:0002757	0.777	immune response-activating signaling pathway
GO:0050851	0.678	antigen receptor-mediated signaling pathway
GO:0033227	0.614	dsRNA transport
GO:0032103	0.536	positive regulation of response to external stimulus
GO:0002833	0.494	positive regulation of response to biotic stimulus
GO:0031349	0.492	positive regulation of defense response
GO:0002218	0.428	activation of innate immune response
GO:0002758	0.404	innate immune response-activating signaling pathway
GO:0071840	0.395	cellular component organization or biogenesis
GO:0016043	0.366	cellular component organization
GO:0071704	0.346	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.999	protein-containing complex
GO:0070062	0.999	extracellular exosome
GO:0005768	0.999	endosome
GO:0045121	0.998	membrane raft
GO:0070013	0.340	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]