StarFunc result for job id Q14703

User Input

>input (1052 residues)
MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAF
NGYFTAKARNSFISSALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDH
PNIKRVTPQRKVFRSLKYAESDPTVPCNETRWSQKWQSSRPLRRASLSLGSGFWHATGRH
SSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNE
RTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKK
IDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGG
IDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV
AGAVTLLVSTVQKRELVNPASMKQALIASARRLPGVNMFEQGHGKLDLLRAYQILNSYKP
QASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVTGRIVDKPDWQPYLPQ
NGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGHVMITVASPAETESKNGAE
QTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHIHTN
FRDMYQHLRSMGYFVEVLGAPFTCFDASQYGTLLMVDSEEEYFPEEIAKLRRDVDNGLSL
VIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGEFTL
ANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGR
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERM
EGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKV
VLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQ
INKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q4U2	0.541	0.573	0.000	981	0.738	0.791	A0A2R8Q4U2.pdb.gz
2	AFDB:Q0WUG6	0.755	0.765	0.000	1038	0.437	0.443	Q0WUG6.pdb.gz	SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana OX=3702 GN=SBT6.1 PE=1 SV=1
3	AFDB:Q14703	1.000	1.000	0.000	1052	1.000	1.000	Q14703.pdb.gz	MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens OX=9606 GN=MBTPS1 PE=1 SV=1
4	AFDB:Q1LWH3	0.857	0.839	0.000	1074	0.836	0.818	Q1LWH3.pdb.gz	Q1LWH3_DANRE Membrane-bound transcription factor peptidase, site 1 OS=Danio rerio OX=7955 GN=goz1 PE=1 SV=1
5	AFDB:Q5JIZ5	0.309	0.474	1.403E-22	663	0.109	0.173	Q5JIZ5.pdb.gz	TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1689 PE=1 SV=1
6	PDB:3wivC	0.283	0.708	3.595E-18	397	0.089	0.237	3wivC.pdb.gz	Requirement of the insertion sequence for activation of Tk-subtilisin
7	AFDB:P30432	0.295	0.195	8.302E-17	1679	0.083	0.052	P30432.pdb.gz	FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster OX=7227 GN=Fur2 PE=2 SV=2
8	PDB:1r6vA	0.295	0.446	2.336E-16	671	0.106	0.167	1r6vA.pdb.gz	Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
9	PDB:2x8jD	0.236	0.761	1.087E-15	308	0.077	0.263	2x8jD.pdb.gz
10	AFDB:Q2UUJ5	0.303	0.372	3.880E-15	836	0.089	0.112	Q2UUJ5.pdb.gz	Q2UUJ5_ASPOR P/Homo B domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090009000291 PE=3 SV=1
11	AFDB:A0A1D8PEG3	0.298	0.331	1.230E-14	936	0.089	0.100	A0A1D8PEG3.pdb.gz	A0A1D8PEG3_CANAL Kexin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEX2 PE=3 SV=1
12	PDB:3lxuX	0.219	0.193	1.287E-14	1217	0.076	0.066	3lxuX.pdb.gz
13	AFDB:A2Q9N6	0.290	0.351	2.814E-13	844	0.094	0.117	A2Q9N6.pdb.gz	A2Q9N6_ASPNC Kexin kexB-Aspergillus niger OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=kexB PE=3 SV=1
14	PDB:6u3xB	0.221	0.446	9.985E-10	486	0.063	0.136	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
15	PDB:3edyA	0.237	0.418	2.285E-8	544	0.062	0.119	3edyA.pdb.gz	Crystal Structure and Autoactivation Pathway of the Precursor Form of Human Tripeptidyl-peptidase 1, the Enzyme Deficient in Late Infantile Ceroid Lipofuscinosis
16	PDB:2waaA	0.087	0.206	1.772E-3	335	0.034	0.107	2waaA.pdb.gz
17	PDB:2jtyA	0.081	0.352	1.873E-3	184	0.015	0.087	2jtyA.pdb.gz
18	PDB:1rowA	0.069	0.494	2.208E-3	107	0.013	0.131	1rowA.pdb.gz
19	PDB:2mspA	0.077	0.448	3.243E-3	124	0.018	0.153	2mspA.pdb.gz
20	AFDB:Q4WK23	0.118	0.117	3.667E-2	1068	0.089	0.088	Q4WK23.pdb.gz	Q4WK23_ASPFU Eukaryotic translation initiation factor 5B OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G03970 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WUG6	0.0	867	1038	0.423	0.429	SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana OX=3702 GN=SBT6.1 PE=1 SV=1
2	Q14703	0.0	2186	1052	1.000	1.000	MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens OX=9606 GN=MBTPS1 PE=1 SV=1
3	Q1LWH3	0.0	1857	1074	0.831	0.814	Q1LWH3_DANRE Membrane-bound transcription factor peptidase, site 1 OS=Danio rerio OX=7955 GN=goz1 PE=1 SV=1
4	Q9WTZ2	0.0	2067	1052	0.958	0.958	MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus OX=10090 GN=Mbtps1 PE=1 SV=1
5	Q9WTZ3	0.0	2133	1052	0.968	0.968	MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus OX=10116 GN=Mbtps1 PE=1 SV=2
6	Q9Z2A8	0.0	2137	1052	0.971	0.971	MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus OX=10029 GN=MBTPS1 PE=1 SV=2
7	P00782	2.57e-22	102	382	0.077	0.212	SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens OX=1390 GN=apr PE=1 SV=1
8	D0AB41	3.94e-22	100	321	0.086	0.280	D0AB41_ALKCL Intracellular subtilisin protease OS=Alkalihalobacillus clausii OX=79880 GN=isp PE=1 SV=1
9	Q5JIZ5	1.79e-16	86.7	663	0.087	0.139	TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1689 PE=1 SV=1
10	D2D3C3	3.71e-11	70.1	1431	0.076	0.056	D2D3C3_BACAM Bacillopeptidase OS=Bacillus amyloliquefaciens OX=1390 PE=3 SV=2
11	P58502	4.61e-11	68.6	422	0.067	0.166	TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1675 PE=1 SV=1
12	Q09541	5.12e-11	69.7	1374	0.067	0.052	TPP2_CAEEL Tripeptidyl-peptidase 2 OS=Caenorhabditis elegans OX=6239 GN=tpp-2 PE=2 SV=1
13	Q9V6K1	1.64e-10	68.2	1441	0.070	0.051	TPP2_DROME Tripeptidyl-peptidase 2 OS=Drosophila melanogaster OX=7227 GN=TppII PE=1 SV=2
14	P29144	7.02e-10	65.9	1249	0.064	0.054	TPP2_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4
15	Q5VZU9	7.16e-10	65.9	1262	0.064	0.053	Q5VZU9_HUMAN Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
16	A0A494C0U1	8.91e-10	65.5	1179	0.064	0.057	A0A494C0U1_HUMAN Tripeptidyl-peptidase 2 (Fragment) OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=1
17	Q64560	2.36e-09	64.3	1249	0.064	0.054	TPP2_RAT Tripeptidyl-peptidase 2 OS=Rattus norvegicus OX=10116 GN=Tpp2 PE=2 SV=3
18	A9QY39	8.90e-09	62.0	750	0.051	0.072	SBT3_LOTJA Subtilisin-like protease 3 OS=Lotus japonicus OX=34305 GN=SBTM3 PE=2 SV=1
19	P12547	1.83e-08	60.5	403	0.060	0.156	ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alp1 PE=1 SV=2
20	P25381	5.50e-08	58.9	491	0.064	0.136	RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRT12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14258 DUF4350	1.3e+02	14.2	Domain of unknown function (DUF4350)
2	PF00082 Peptidase_S8	2.5e-39	146.8	Subtilase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344223

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265565	0.974	Sterol regulatory element-binding protein cleavage-activating protein
2	9606.ENSP00000356919	0.972	Cyclic AMP-dependent transcription factor ATF-6 alpha
3	9606.ENSP00000354476	0.968	Sterol regulatory element-binding protein 2
4	9606.ENSP00000481956	0.966	Cyclic AMP-responsive element-binding protein 3-like protein 1
5	9606.ENSP00000078445	0.965	Cyclic AMP-responsive element-binding protein 3-like protein 3
6	9606.ENSP00000368798	0.961	Membrane-bound transcription factor site-2 protease
7	9606.ENSP00000329140	0.960	Cyclic AMP-responsive element-binding protein 3-like protein 2
8	9606.ENSP00000348069	0.960	Sterol regulatory element-binding protein 1
9	9606.ENSP00000357596	0.958	Cyclic AMP-responsive element-binding protein 3-like protein 4
10	9606.ENSP00000342136	0.954	Cyclic AMP-responsive element-binding protein 3
11	9606.ENSP00000216044	0.767	GTP-binding protein 1
12	9606.ENSP00000482760	0.716	Proprotein convertase subtilisin/kexin type 6
13	9606.ENSP00000370767	0.703	Pancreatic secretory granule membrane major glycoprotein GP2
14	9606.ENSP00000325917	0.701	Proprotein convertase subtilisin/kexin type 7
15	9606.ENSP00000483552	0.696	Furin
16	9606.ENSP00000401445	0.675	Serine/threonine-protein kinase/endoribonuclease IRE1
17	9606.ENSP00000466933	0.672	Sphingosine 1-phosphate receptor 2
18	9606.ENSP00000446280	0.666	Proprotein convertase subtilisin/kexin type 5
19	9606.ENSP00000300954	0.661	Proprotein convertase subtilisin/kexin type 4
20	9606.ENSP00000216037	0.660	X-box-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004252	1.000	serine-type endopeptidase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0009987	0.920	cellular process
GO:0050896	0.827	response to stimulus
GO:0065007	0.761	biological regulation
GO:0051716	0.689	cellular response to stimulus
GO:0006807	0.644	nitrogen compound metabolic process
GO:0050789	0.643	regulation of biological process
GO:0050794	0.627	regulation of cellular process
GO:0043170	0.583	macromolecule metabolic process
GO:0006629	0.578	lipid metabolic process
GO:1901564	0.567	organonitrogen compound metabolic process
GO:0019538	0.555	protein metabolic process
GO:0006950	0.504	response to stress
GO:0006508	0.503	proteolysis
GO:0034976	0.493	response to endoplasmic reticulum stress
GO:0019222	0.310	regulation of metabolic process
GO:0080090	0.301	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.989	membrane
GO:0031090	0.946	organelle membrane
GO:0005783	0.944	endoplasmic reticulum
GO:0098588	0.899	bounding membrane of organelle
GO:0031974	0.897	membrane-enclosed lumen
GO:0070013	0.850	intracellular organelle lumen
GO:0000139	0.694	Golgi membrane
GO:0031984	0.407	organelle subcompartment
GO:0005789	0.401	endoplasmic reticulum membrane
GO:0031981	0.359	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]