StarFunc result for job id Q14722

User Input

>input (419 residues)
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQL
ALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEV
AERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE
RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLAC
GIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
AWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14722	1.000	1.000	8.428E-83	419	1.000	1.000	Q14722.pdb.gz	KCAB1_HUMAN Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNAB1 PE=1 SV=1
2	AFDB:P63143	0.814	0.850	3.367E-67	401	0.811	0.848	P63143.pdb.gz	KCAB1_MOUSE Voltage-gated potassium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Kcnab1 PE=1 SV=2
3	AFDB:P62482	0.787	0.898	2.017E-62	367	0.687	0.785	P62482.pdb.gz	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
4	AFDB:E9QGU5	0.801	0.814	2.395E-62	412	0.692	0.704	E9QGU5.pdb.gz	E9QGU5_DANRE Voltage-gated potassium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:171453 PE=3 SV=1
5	AFDB:O43448	0.791	0.820	1.911E-57	404	0.613	0.636	O43448.pdb.gz	KCAB3_HUMAN Voltage-gated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNAB3 PE=1 SV=2
6	PDB:2a79A	0.769	0.989	9.076E-56	326	0.654	0.840	2a79A.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
7	AFDB:E7F8K2	0.727	0.887	4.528E-52	343	0.623	0.761	E7F8K2.pdb.gz
8	AFDB:O23016	0.768	0.978	1.383E-43	328	0.375	0.479	O23016.pdb.gz	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
9	AFDB:O59826	0.753	0.914	1.054E-39	344	0.358	0.436	O59826.pdb.gz	KCAB_SCHPO Putative voltage-gated potassium channel subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.06 PE=3 SV=1
10	AFDB:M9PE66	0.704	0.543	1.666E-39	548	0.425	0.325	M9PE66.pdb.gz	M9PE66_DROME Hyperkinetic, isoform K OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
11	AFDB:M9NEC7	0.705	0.433	5.549E-39	698	0.411	0.246	M9NEC7.pdb.gz	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
12	PDB:4aubB	0.690	0.857	1.601E-28	335	0.260	0.325	4aubB.pdb.gz	The Diversity of Microbial Aldo/Keto Reductases from Escherichia Coli K12.
13	PDB:4astD	0.648	0.874	3.151E-27	308	0.243	0.331	4astD.pdb.gz
14	PDB:1lqaA	0.683	0.821	3.920E-26	346	0.239	0.289	1lqaA.pdb.gz	Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
15	PDB:1gveA	0.641	0.817	8.193E-20	324	0.189	0.244	1gveA.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
16	PDB:2c91A	0.629	0.799	2.729E-19	325	0.191	0.246	2c91A.pdb.gz	Crystal Structure of Mouse Succinic Semialdehyde Reductase Akr7A5: Structural Basis for Substrate Specificity.
17	PDB:2clpA	0.641	0.819	3.849E-19	323	0.184	0.238	2clpA.pdb.gz	Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
18	PDB:1gveB	0.604	0.825	1.210E-18	301	0.184	0.256	1gveB.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
19	PDB:4gacA	0.565	0.720	1.422E-17	324	0.158	0.204	4gacA.pdb.gz
20	PDB:3h7rA	0.542	0.725	1.490E-16	307	0.172	0.235	3h7rA.pdb.gz	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QGU5	0.0	601	412	0.678	0.689	E9QGU5_DANRE Voltage-gated potassium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:171453 PE=3 SV=1
2	H0YWU3	0.0	613	398	0.678	0.714	H0YWU3_TAEGU Voltage-gated potassium channel subunit beta-2 OS=Taeniopygia guttata OX=59729 GN=KCNAB2 PE=3 SV=1
3	O43448	0.0	533	404	0.592	0.614	KCAB3_HUMAN Voltage-gated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNAB3 PE=1 SV=2
4	P62482	0.0	604	367	0.668	0.763	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
5	P62483	0.0	604	367	0.668	0.763	KCAB2_RAT Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnab2 PE=1 SV=1
6	P63143	0.0	693	401	0.814	0.850	KCAB1_MOUSE Voltage-gated potassium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Kcnab1 PE=1 SV=2
7	P63144	0.0	694	401	0.814	0.850	KCAB1_RAT Voltage-gated potassium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Kcnab1 PE=1 SV=1
8	Q13303	0.0	602	367	0.661	0.755	KCAB2_HUMAN Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNAB2 PE=1 SV=2
9	Q14722	0.0	865	419	1.000	1.000	KCAB1_HUMAN Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNAB1 PE=1 SV=1
10	P97382	1.15e-118	347	249	0.382	0.643	KCAB3_MOUSE Voltage-gated potassium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Kcnab3 PE=1 SV=1
11	O23016	3.50e-115	341	328	0.377	0.482	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
12	M9NGY7	3.98e-114	341	393	0.399	0.425	M9NGY7_DROME Hyperkinetic, isoform I OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
13	M9NF11	5.34e-112	335	374	0.396	0.444	M9NF11_DROME Hyperkinetic, isoform H OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
14	Q9W2W9	1.20e-111	335	392	0.396	0.423	Q9W2W9_DROME HL08167p OS=Drosophila melanogaster OX=7227 GN=Hk PE=2 SV=2
15	Q24052	8.69e-110	335	546	0.396	0.304	Q24052_DROME Hk protein OS=Drosophila melanogaster OX=7227 GN=Hk PE=2 SV=1
16	Q9W2X0	1.29e-109	335	547	0.396	0.303	Q9W2X0_DROME Hyperkinetic, isoform E OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=3
17	M9PE66	1.61e-109	335	548	0.396	0.303	M9PE66_DROME Hyperkinetic, isoform K OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
18	M9PGS8	4.31e-109	335	596	0.396	0.279	M9PGS8_DROME Hyperkinetic, isoform L OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
19	M9NEC7	8.90e-109	337	698	0.394	0.236	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
20	M9PHI0	4.38e-107	338	887	0.394	0.186	M9PHI0_DROME Hyperkinetic, isoform M OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	3.5e-56	202.0	Aldo/keto reductase family
2	PF10886 DUF2685	3.7e+02	12.7	Protein of unknown function (DUF2685)
3	PF13887 MYRF_ICA	5.4e+02	11.2	Myelin regulatory factor ICA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419952

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371985	0.989	Potassium voltage-gated channel subfamily A member 1
2	9606.ENSP00000433109	0.985	Potassium voltage-gated channel subfamily A member 2
3	9606.ENSP00000252321	0.975	Potassium voltage-gated channel subfamily A member 5
4	9606.ENSP00000265969	0.945	Potassium voltage-gated channel subfamily C member 1
5	9606.ENSP00000328511	0.945	Potassium voltage-gated channel subfamily A member 4
6	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
7	9606.ENSP00000333496	0.934	Potassium voltage-gated channel subfamily D member 2
8	9606.ENSP00000358784	0.921	Potassium voltage-gated channel subfamily A member 3
9	9606.ENSP00000360806	0.899	Potassium voltage-gated channel subfamily B member 1
10	9606.ENSP00000271751	0.897	Potassium voltage-gated channel subfamily H member 1
11	9606.ENSP00000319591	0.877	Potassium voltage-gated channel subfamily D member 3
12	9606.ENSP00000435954	0.874	Potassium voltage-gated channel subfamily V member 1
13	9606.ENSP00000321427	0.872	Potassium voltage-gated channel subfamily H member 5
14	9606.ENSP00000358786	0.868	Potassium voltage-gated channel subfamily A member 10
15	9606.ENSP00000385968	0.868	Potassium voltage-gated channel subfamily S member 3
16	9606.ENSP00000358802	0.846	Potassium voltage-gated channel subfamily C member 4
17	9606.ENSP00000449253	0.845	Potassium voltage-gated channel subfamily C member 2
18	9606.ENSP00000295082	0.835	Potassium voltage-gated channel subfamily F member 1
19	9606.ENSP00000221444	0.834	Potassium voltage-gated channel subfamily A member 7
20	9606.ENSP00000352035	0.826	Potassium voltage-gated channel subfamily KQT member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015459	0.999	potassium channel regulator activity
GO:0016614	0.966	oxidoreductase activity, acting on CH-OH group of donors
GO:0016616	0.963	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0097159	0.542	organic cyclic compound binding
GO:1901363	0.527	heterocyclic compound binding
GO:0004033	0.444	aldo-keto reductase (NADP) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.985	regulation of cellular process
GO:0034762	0.971	regulation of transmembrane transport
GO:0043266	0.967	regulation of potassium ion transport
GO:1901379	0.958	regulation of potassium ion transmembrane transport
GO:0006810	0.876	transport
GO:0030001	0.865	metal ion transport
GO:0006813	0.794	potassium ion transport
GO:0009987	0.770	cellular process
GO:0032412	0.648	regulation of monoatomic ion transmembrane transporter activity
GO:1901016	0.639	regulation of potassium ion transmembrane transporter activity
GO:0032501	0.338	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0034705	0.999	potassium channel complex
GO:0098797	0.985	plasma membrane protein complex
GO:0008076	0.979	voltage-gated potassium channel complex
GO:0005622	0.826	intracellular anatomical structure
GO:0005737	0.816	cytoplasm
GO:0120025	0.565	plasma membrane bounded cell projection
GO:0043005	0.418	neuron projection
GO:0030424	0.390	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	0.966	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.963	With NAD(+) or NADP(+) as acceptor.

[back to server]