StarFunc result for job id Q14738

User Input

>input (602 residues)
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13362	0.761	0.873	7.880E-52	524	0.681	0.782	Q13362.pdb.gz	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
2	AFDB:A9UJN4	0.748	0.742	7.597E-49	607	0.606	0.601	A9UJN4.pdb.gz	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
3	AFDB:A4FV68	0.699	0.895	6.784E-43	467	0.513	0.662	A4FV68.pdb.gz	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
4	AFDB:Q15173	0.702	0.847	7.163E-42	497	0.517	0.626	Q15173.pdb.gz	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
5	AFDB:Q9VB23	0.713	0.817	1.795E-41	524	0.523	0.601	Q9VB23.pdb.gz	Q9VB23_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wdb PE=1 SV=2
6	AFDB:Q15172	0.689	0.849	2.677E-41	486	0.505	0.626	Q15172.pdb.gz	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
7	AFDB:Q6DFL3	0.690	0.869	3.402E-41	476	0.488	0.618	Q6DFL3.pdb.gz	Q6DFL3_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5b.L PE=2 SV=1
8	AFDB:O18178	0.712	0.789	3.592E-40	542	0.492	0.546	O18178.pdb.gz	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
9	AFDB:Q10428	0.731	0.802	9.002E-40	548	0.452	0.496	Q10428.pdb.gz	2AD1_SCHPO Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 1 isoform OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=par1 PE=1 SV=1
10	AFDB:P38903	0.718	0.573	1.496E-37	757	0.460	0.366	P38903.pdb.gz	2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTS1 PE=1 SV=2
11	PDB:6ntsB	0.570	0.935	2.559E-30	361	0.442	0.737	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
12	PDB:5tbkA	0.269	0.351	2.305E-4	417	0.093	0.134	5tbkA.pdb.gz
13	PDB:3tpoA	0.290	0.358	4.925E-4	438	0.096	0.132	3tpoA.pdb.gz
14	PDB:1b3uA	0.242	0.245	5.125E-4	588	0.085	0.087	1b3uA.pdb.gz
15	PDB:3w3zA	0.397	0.257	9.712E-4	1013	0.106	0.063	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:1wa5B	0.292	0.349	1.139E-3	466	0.095	0.122	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
17	PDB:3w3uA	0.360	0.234	1.337E-3	1030	0.100	0.058	3w3uA.pdb.gz
18	PDB:7wttK	0.346	0.221	1.391E-3	1022	0.083	0.049	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:6xu2A	0.307	0.194	3.351E-3	1091	0.110	0.060	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:4jlqA	0.334	0.258	3.629E-3	840	0.098	0.070	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHB9	771	716	0.625	0.525	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
2	A0A0B4KHP7	744	683	0.576	0.508	A0A0B4KHP7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
3	A0A8I6A6K6	1196	671	0.977	0.876	A0A8I6A6K6_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=1
4	A4FV68	610	467	0.482	0.621	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
5	A9UJN4	744	607	0.601	0.596	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	B7Z0L6	771	703	0.625	0.535	B7Z0L6_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	B7Z0L7	646	438	0.495	0.680	B7Z0L7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
8	F1MAA3	1186	592	0.972	0.988	F1MAA3_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=3
9	O18178	604	542	0.475	0.528	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
10	Q0KI58	744	670	0.576	0.518	Q0KI58_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	Q13362	823	524	0.671	0.771	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
12	Q14738	1235	602	1.000	1.000	2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1
13	Q15172	618	486	0.482	0.597	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
14	Q15173	602	497	0.510	0.618	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
15	Q16537	610	467	0.482	0.621	2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1
16	Q499R1	1195	622	0.977	0.945	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
17	Q5BIJ2	743	656	0.576	0.529	Q5BIJ2_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
18	Q5XH34	604	467	0.478	0.617	Q5XH34_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5e.S PE=1 SV=1
19	Q60996	827	524	0.669	0.769	2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2
20	Q61151	611	467	0.483	0.623	2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus OX=10090 GN=Ppp2r5e PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01603 B56	6.9e-185	626.5	Protein phosphatase 2A regulatory B subunit (B56 family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005553017.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005557833.1	0.998	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
2	9541.XP_005590239.1	0.998	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
3	9541.XP_005563058.1	0.997	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
4	9541.XP_005579655.1	0.988	Protein phosphatase 2 scaffold subunit Abeta
5	9541.XP_005545723.1	0.939	Uncharacterized protein
6	9541.XP_005562405.1	0.925	Belongs to the protein kinase superfamily.
7	9541.XP_005539712.1	0.921	Belongs to the protein kinase superfamily.
8	9541.XP_005589304.1	0.921	Belongs to the protein kinase superfamily.
9	9541.XP_005562936.1	0.881	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
10	9541.XP_005577146.1	0.879	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform X1
11	9541.XP_005540832.1	0.858	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
12	9541.XP_005566900.1	0.851	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
13	9541.XP_005580717.1	0.838	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides
14	9541.XP_005561003.1	0.836	Meiotic recombination protein REC8 homolog isoform X1
15	9541.XP_005579152.1	0.800	Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta- arrestins bind to the GPRK-phosphorylated receptor and sterically preclude its coupling to the cognate G-protein
16	9541.XP_005559212.1	0.792	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta isoform X1
17	9541.XP_005572314.1	0.783	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
18	9541.XP_005591678.1	0.781	Serine/threonine-protein phosphatase
19	9541.XP_005573242.1	0.778	Uncharacterized protein
20	9541.XP_005558205.1	0.772	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.494	molecular function regulator activity
GO:0019208	0.436	phosphatase regulator activity
GO:0019888	0.433	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051174	0.995	regulation of phosphorus metabolic process
GO:0031399	0.988	regulation of protein modification process
GO:0019220	0.984	regulation of phosphate metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0009987	0.958	cellular process
GO:0048522	0.947	positive regulation of cellular process
GO:0009893	0.871	positive regulation of metabolic process
GO:0035303	0.832	regulation of dephosphorylation
GO:0045937	0.815	positive regulation of phosphate metabolic process
GO:0051173	0.804	positive regulation of nitrogen compound metabolic process
GO:0031401	0.793	positive regulation of protein modification process
GO:0035304	0.730	regulation of protein dephosphorylation
GO:0008152	0.675	metabolic process
GO:0035306	0.670	positive regulation of dephosphorylation
GO:0035307	0.645	positive regulation of protein dephosphorylation
GO:0071704	0.622	organic substance metabolic process
GO:0044238	0.588	primary metabolic process
GO:0044237	0.583	cellular metabolic process
GO:0050896	0.576	response to stimulus
GO:0048519	0.547	negative regulation of biological process
GO:0006807	0.543	nitrogen compound metabolic process
GO:0043170	0.490	macromolecule metabolic process
GO:1901564	0.457	organonitrogen compound metabolic process
GO:0019538	0.444	protein metabolic process
GO:0048523	0.443	negative regulation of cellular process
GO:0023052	0.439	signaling
GO:0007154	0.435	cell communication
GO:0051716	0.427	cellular response to stimulus
GO:0036211	0.417	protein modification process
GO:0032501	0.368	multicellular organismal process
GO:0007165	0.348	signal transduction
GO:0032502	0.333	developmental process
GO:0042325	0.324	regulation of phosphorylation
GO:0048856	0.321	anatomical structure development
GO:0009892	0.300	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.995	nucleus
GO:0005654	0.992	nucleoplasm
GO:0032991	0.891	protein-containing complex
GO:0043228	0.531	non-membrane-bounded organelle
GO:0043232	0.383	intracellular non-membrane-bounded organelle
GO:1902494	0.356	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]