StarFunc result for job id Q14765

User Input

>input (748 residues)
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P42228	0.949	0.948	0.000	749	0.947	0.945	P42228.pdb.gz	STAT4_MOUSE Signal transducer and activator of transcription 4 OS=Mus musculus OX=10090 GN=Stat4 PE=1 SV=1
2	AFDB:A0A2R8Q947	0.929	0.937	1.653E-81	741	0.606	0.611	A0A2R8Q947.pdb.gz
3	AFDB:Q8AW24	0.775	0.878	6.521E-73	657	0.563	0.641	Q8AW24.pdb.gz
4	AFDB:A0A669KB53	0.801	0.760	2.053E-70	791	0.527	0.498	A0A669KB53.pdb.gz	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
5	AFDB:C0SPC7	0.783	0.730	5.905E-68	806	0.485	0.450	C0SPC7.pdb.gz
6	AFDB:B5X3E8	0.777	0.756	2.099E-67	770	0.495	0.481	B5X3E8.pdb.gz	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
7	AFDB:P40763	0.791	0.770	3.957E-67	770	0.473	0.460	P40763.pdb.gz	STAT3_HUMAN Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2
8	AFDB:O13133	0.780	0.762	6.513E-67	767	0.469	0.458	O13133.pdb.gz	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1
9	AFDB:B0S789	0.762	0.785	4.233E-64	725	0.434	0.448	B0S789.pdb.gz	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
10	PDB:1yvlB	0.707	0.806	1.847E-60	653	0.495	0.567	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
11	AFDB:X2KK07	0.754	0.697	4.773E-60	813	0.433	0.399	X2KK07.pdb.gz	X2KK07_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
12	PDB:6wczA	0.432	0.891	1.751E-18	350	0.187	0.400	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
13	PDB:7mjpA	0.099	0.177	1.093E-2	366	0.028	0.057	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
14	PDB:7cunG	0.101	0.092	1.144E-2	895	0.074	0.061	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
15	PDB:4lmhD	0.084	0.089	2.585E-2	695	0.044	0.047	4lmhD.pdb.gz	Insights into electron transfer at the microbe-mineral interface: the X-ray crystal structures of Shewanella oneidensis MtrC and OmcA
16	PDB:4fl2A	0.054	0.068	2.830E-2	555	0.040	0.054	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:1ka6A	0.064	0.369	6.112E-2	107	0.032	0.224	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
18	PDB:1xl6A	0.094	0.196	6.395E-2	291	0.024	0.062	1xl6A.pdb.gz
19	PDB:6gn0A	0.073	0.157	6.691E-2	239	0.035	0.109	6gn0A.pdb.gz
20	PDB:7tysA	0.097	0.166	6.691E-2	361	0.036	0.075	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RIE1	763	750	0.533	0.532	A0A0D9RIE1_CHLSB Signal transducer and activator of transcription OS=Chlorocebus sabaeus OX=60711 GN=STAT1 PE=3 SV=1
2	A0A0G2JX93	635	1205	0.473	0.294	A0A0G2JX93_RAT Signal transducer and activator of transcription 1 OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=2
3	A0A0G2JXH1	1381	704	0.892	0.947	A0A0G2JXH1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
4	A0A0R4IGF2	705	738	0.479	0.485	A0A0R4IGF2_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=z-Stat3 PE=1 SV=2
5	A0A669KB53	759	791	0.532	0.503	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
6	A0A669KB56	761	748	0.532	0.532	A0A669KB56_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
7	A0A669KB68	758	748	0.531	0.531	A0A669KB68_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
8	A0A669KBA4	759	779	0.532	0.511	A0A669KBA4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
9	A7LH49	712	739	0.499	0.505	A7LH49_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=LOC100136558 PE=2 SV=1
10	B0JYL6	766	747	0.528	0.529	B0JYL6_BOVIN Signal transducer and activator of transcription OS=Bos taurus OX=9913 GN=STAT1 PE=1 SV=1
11	B0S789	645	725	0.436	0.450	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
12	B0S790	920	731	0.608	0.622	B0S790_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
13	B5X3E8	723	770	0.503	0.488	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
14	C7EY83	723	757	0.503	0.497	C7EY83_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1a PE=2 SV=1
15	F1M9D6	763	755	0.532	0.527	F1M9D6_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=3
16	F7FAC1	1453	749	0.941	0.940	F7FAC1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
17	G8JLH9	604	672	0.412	0.458	G8JLH9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=1
18	J3KPM9	753	714	0.524	0.549	J3KPM9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
19	O13133	689	767	0.472	0.460	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1
20	O93599	712	806	0.493	0.458	O93599_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT3b1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08624 CRC_subunit	5.7e+02	12.4	Chromatin remodelling complex Rsc7/Swp82 subunit
2	PF05531 NPV_P10	7.2e+02	12.1	Nucleopolyhedrovirus P10 protein
3	PF00017 SH2	3.2e-08	44.9	SH2 domain
4	PF01017 STAT_alpha	9.7e-50	180.3	STAT protein, all-alpha domain
5	PF02864 STAT_bind	4.8e-31	119.5	STAT protein, DNA binding domain
6	PF02865 STAT_int	1.1e-36	137.2	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008948871.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003823415.1	0.979	Janus kinase 2
2	9597.XP_003807011.1	0.978	Interleukin-12 receptor subunit beta-2
3	9597.XP_008957192.1	0.971	Janus kinase 1
4	9597.XP_008959476.1	0.971	Interferon regulatory factor 9 isoform X1
5	9597.XP_003817831.1	0.965	Interleukin-12 receptor subunit beta-1 isoform X1
6	9597.XP_008960098.1	0.956	Tyrosine kinase 2
7	9597.XP_008970438.1	0.941	Cytokine inducible SH2 containing protein
8	9597.XP_003825332.1	0.932	Signal transducer and activator of transcription 1
9	9597.XP_008964734.1	0.928	Signal transducer and activator of transcription 3
10	9597.XP_008965629.1	0.924	E1A binding protein p300
11	9597.XP_008966263.1	0.912	CREB binding protein
12	9597.XP_003828059.1	0.909	Protein inhibitor of activated STAT 1
13	9597.XP_008953866.1	0.903	E3 SUMO-protein ligase PIAS2 isoform X1
14	9597.XP_003819318.1	0.891	Protein inhibitor of activated STAT 4
15	9597.XP_003813928.1	0.884	Signal transducer and activator of transcription 5A isoform X1
16	9597.XP_008964732.1	0.878	Signal transducer and activator of transcription 5B
17	9597.XP_003806249.1	0.862	E3 SUMO-protein ligase PIAS3 isoform X1
18	9597.XP_003824035.1	0.855	Interferon alpha/beta receptor 1 isoform X1
19	9597.XP_008976837.1	0.852	Signal transducer and activator of transcription 2 isoform X1
20	9597.XP_003824932.1	0.846	Signal transducer and activator of transcription 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0019899	0.992	enzyme binding
GO:0005102	0.957	signaling receptor binding
GO:1990837	0.929	sequence-specific double-stranded DNA binding
GO:0000981	0.918	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.914	transcription cis-regulatory region binding
GO:0000987	0.875	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.851	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.850	transcription factor binding
GO:0140297	0.828	DNA-binding transcription factor binding
GO:0061629	0.810	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001228	0.796	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.793	identical protein binding
GO:0005126	0.779	cytokine receptor binding
GO:0019902	0.614	phosphatase binding
GO:0019903	0.589	protein phosphatase binding
GO:0000978	0.577	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001664	0.535	G protein-coupled receptor binding
GO:0042379	0.533	chemokine receptor binding
GO:0051721	0.363	protein phosphatase 2A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007259	0.986	receptor signaling pathway via JAK-STAT
GO:0019222	0.981	regulation of metabolic process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0009889	0.959	regulation of biosynthetic process
GO:0042221	0.955	response to chemical
GO:0034097	0.949	response to cytokine
GO:0048518	0.935	positive regulation of biological process
GO:0032501	0.912	multicellular organismal process
GO:0009605	0.910	response to external stimulus
GO:0071310	0.897	cellular response to organic substance
GO:0048522	0.896	positive regulation of cellular process
GO:1901699	0.885	cellular response to nitrogen compound
GO:1901652	0.858	response to peptide
GO:0009893	0.848	positive regulation of metabolic process
GO:0010556	0.838	regulation of macromolecule biosynthetic process
GO:0008284	0.837	positive regulation of cell population proliferation
GO:0010604	0.791	positive regulation of macromolecule metabolic process
GO:0009719	0.757	response to endogenous stimulus
GO:0043434	0.740	response to peptide hormone
GO:0031323	0.728	regulation of cellular metabolic process
GO:0010468	0.661	regulation of gene expression
GO:0080090	0.659	regulation of primary metabolic process
GO:0051171	0.659	regulation of nitrogen compound metabolic process
GO:0009991	0.591	response to extracellular stimulus
GO:0006355	0.544	regulation of DNA-templated transcription
GO:0009891	0.523	positive regulation of biosynthetic process
GO:0071345	0.521	cellular response to cytokine stimulus
GO:0010557	0.504	positive regulation of macromolecule biosynthetic process
GO:0032502	0.497	developmental process
GO:0006950	0.474	response to stress
GO:0031325	0.469	positive regulation of cellular metabolic process
GO:0051239	0.464	regulation of multicellular organismal process
GO:0048856	0.450	anatomical structure development
GO:0051173	0.449	positive regulation of nitrogen compound metabolic process
GO:0014070	0.443	response to organic cyclic compound
GO:0048519	0.410	negative regulation of biological process
GO:0051240	0.400	positive regulation of multicellular organismal process
GO:1901701	0.381	cellular response to oxygen-containing compound
GO:1901653	0.356	cellular response to peptide
GO:0008152	0.343	metabolic process
GO:0071375	0.333	cellular response to peptide hormone stimulus
GO:0048523	0.322	negative regulation of cellular process
GO:0002376	0.312	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.977	cytosol
GO:0031974	0.938	membrane-enclosed lumen
GO:0031981	0.929	nuclear lumen
GO:0005654	0.804	nucleoplasm
GO:0016020	0.574	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]