StarFunc result for job id Q14766

User Input

>input (1721 residues)
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHP
NPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAAS
SWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVVIH
HGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPP
NIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKK
PSYHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDP
TFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEP
VEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCIC
YEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDE
CLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSY
QCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDI
DECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEG
SFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTC
QDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY
SPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGW
GDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGF
CLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLD
ASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGM
QCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEEL
QAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14766	1.000	1.000	0.000	1721	1.000	1.000	Q14766.pdb.gz	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
2	PDB:7q3nU	0.046	0.186	2.476E-7	292	0.031	0.182	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
3	AFDB:Q9ULI3	0.051	0.062	6.819E-6	1381	0.096	0.119	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
4	PDB:2q7zA	0.058	0.054	9.440E-6	1931	0.060	0.053	2q7zA.pdb.gz
5	AFDB:G8BHR3	0.032	0.043	1.672E-4	913	0.062	0.117	G8BHR3.pdb.gz	G8BHR3_CANPC GH18 domain-containing protein OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CHT21 PE=4 SV=1
6	AFDB:P55066	0.055	0.069	9.247E-4	1268	0.091	0.124	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
7	AFDB:O14594	0.049	0.061	3.673E-3	1321	0.095	0.123	O14594.pdb.gz	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
8	AFDB:Q8CHP0	0.037	0.048	4.579E-3	950	0.100	0.181	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
9	PDB:3t5oA	0.034	0.056	9.856E-3	871	0.038	0.075	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
10	AFDB:Q867Z4	0.028	0.045	1.170E-2	970	0.073	0.129	Q867Z4.pdb.gz	LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
11	AFDB:Q8IXZ2	0.033	0.051	2.031E-2	948	0.084	0.152	Q8IXZ2.pdb.gz	ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZC3H3 PE=1 SV=3
12	PDB:4e0sB	0.024	0.039	2.811E-2	898	0.034	0.066	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
13	PDB:7nycC	0.047	0.077	4.881E-2	809	0.036	0.077	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	AFDB:A0A2R8QK78	0.053	0.057	5.187E-2	1570	0.100	0.110	A0A2R8QK78.pdb.gz
15	AFDB:Q02629	0.027	0.042	1.006E-1	959	0.083	0.148	Q02629.pdb.gz	NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP100 PE=1 SV=1
16	PDB:3b4vD	0.045	0.191	1.392E-1	213	0.017	0.141	3b4vD.pdb.gz
17	PDB:8a7eC	0.037	0.040	1.471E-1	1524	0.028	0.031	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
18	PDB:5es4B	0.047	0.095	2.554E-1	674	0.026	0.065	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
19	PDB:6pxvA	0.034	0.058	9.599E-1	823	0.020	0.041	6pxvA.pdb.gz
20	PDB:4bxwB	0.022	0.113	2.196	287	0.008	0.045	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7YY58	0.0	2513	1338	0.711	0.914	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
2	B7ZLY3	0.0	2684	1353	0.765	0.973	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
3	F1MF86	0.0	1056	1963	0.373	0.327	F1MF86_BOVIN Latent transforming growth factor beta binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=4 SV=1
4	O08999	0.0	1093	1813	0.412	0.391	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
5	Q00918	0.0	3120	1712	0.895	0.900	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
6	Q14766	0.0	3528	1721	1.000	1.000	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
7	Q14767	0.0	1120	1821	0.410	0.388	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
8	Q28019	0.0	1054	1842	0.371	0.347	LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2
9	Q61810	0.0	688	1253	0.275	0.378	LTBP3_MOUSE Latent-transforming growth factor beta-binding protein 3 OS=Mus musculus OX=10090 GN=Ltbp3 PE=1 SV=4
10	Q8CG19	0.0	3094	1712	0.889	0.894	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
11	Q8K4G1	0.0	601	1666	0.203	0.209	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
12	Q8N2S1	0.0	596	1624	0.197	0.209	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
13	Q9NS15	0.0	683	1303	0.274	0.361	LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens OX=9606 GN=LTBP3 PE=1 SV=4
14	Q61554	6.05e-131	457	2873	0.226	0.135	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
15	G3V9M6	1.02e-129	454	2872	0.225	0.135	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
16	P35555	2.16e-128	449	2871	0.217	0.130	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
17	Q9WUH8	6.89e-128	448	2872	0.221	0.133	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
18	P98133	5.84e-127	445	2871	0.217	0.130	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
19	A0A0G2KQ62	6.61e-122	429	2868	0.225	0.135	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
20	B6CS38	2.91e-121	427	2868	0.224	0.135	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	2.4e-64	224.1	Complement Clr-like EGF-like
2	PF00008 EGF	3.6e-27	105.6	EGF-like domain
3	PF12947 EGF_3	3.8e-21	86.3	EGF domain
4	PF07645 EGF_CA	1.9e-92	314.5	Calcium-binding EGF domain
5	PF12946 EGF_MSP1_1	0.42	22.0	MSP1 EGF domain 1
6	PF14670 FXa_inhibition	0.031	25.9	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	7.2e-08	44.0	Human growth factor-like EGF
8	PF06247 Plasmod_Pvs28	7.5e-07	40.6	Pvs28 EGF domain
9	PF00683 TB	1.3e-38	141.9	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.995	Transforming growth factor beta-1
2	9606.ENSP00000346839	0.982	Fibronectin type III domain containing
3	9606.ENSP00000346478	0.954	ADAMTS-like protein 2
4	9606.ENSP00000260356	0.948	Thrombospondin-1
5	9606.ENSP00000238682	0.944	Transforming growth factor beta-3
6	9606.ENSP00000355896	0.839	Transforming growth factor beta-2
7	9606.ENSP00000325527	0.718	Fibrillin-1
8	9606.ENSP00000270328	0.653	A disintegrin and metalloproteinase with thrombospondin motifs 10
9	9606.ENSP00000351807	0.653	Elastin
10	9606.ENSP00000364685	0.643	Microfibrillar-associated protein 2
11	9606.ENSP00000424571	0.625	Fibrillin-2
12	9606.ENSP00000231004	0.589	Protein-lysine 6-oxidase
13	9606.ENSP00000400365	0.558	Laminin subunit alpha-2
14	9606.ENSP00000358730	0.536	Transmembrane domain-containing protein TMIGD3
15	9606.ENSP00000262160	0.535	Mothers against decapentaplegic homolog 2
16	9606.ENSP00000356205	0.535	Adenosine receptor A1
17	9606.ENSP00000355330	0.526	Protein-glutamine gamma-glutamyltransferase 2
18	9606.ENSP00000261921	0.520	Lysyl oxidase homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050431	1.000	transforming growth factor beta binding
GO:0050436	0.798	microfibril binding
GO:0005102	0.382	signaling receptor binding
GO:0005198	0.314	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0009719	0.991	response to endogenous stimulus
GO:0051716	0.989	cellular response to stimulus
GO:0007275	0.988	multicellular organism development
GO:0071363	0.977	cellular response to growth factor stimulus
GO:0048731	0.970	system development
GO:0071559	0.965	response to transforming growth factor beta
GO:0071560	0.944	cellular response to transforming growth factor beta stimulus
GO:0048513	0.932	animal organ development
GO:0007154	0.930	cell communication
GO:0007179	0.886	transforming growth factor beta receptor signaling pathway
GO:0019222	0.881	regulation of metabolic process
GO:0048519	0.870	negative regulation of biological process
GO:0060255	0.821	regulation of macromolecule metabolic process
GO:0042221	0.820	response to chemical
GO:0010033	0.812	response to organic substance
GO:0090287	0.809	regulation of cellular response to growth factor stimulus
GO:0090092	0.808	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051239	0.794	regulation of multicellular organismal process
GO:0010468	0.773	regulation of gene expression
GO:0048523	0.767	negative regulation of cellular process
GO:0048518	0.756	positive regulation of biological process
GO:0051179	0.720	localization
GO:0010712	0.694	regulation of collagen metabolic process
GO:0001817	0.690	regulation of cytokine production
GO:0072359	0.618	circulatory system development
GO:1903844	0.575	regulation of cellular response to transforming growth factor beta stimulus
GO:0071634	0.562	regulation of transforming growth factor beta production
GO:0071840	0.560	cellular component organization or biogenesis
GO:0048585	0.525	negative regulation of response to stimulus
GO:0009605	0.522	response to external stimulus
GO:0016043	0.514	cellular component organization
GO:0048522	0.489	positive regulation of cellular process
GO:0009893	0.475	positive regulation of metabolic process
GO:0009889	0.462	regulation of biosynthetic process
GO:1901700	0.460	response to oxygen-containing compound
GO:0014070	0.452	response to organic cyclic compound
GO:0080090	0.444	regulation of primary metabolic process
GO:0031323	0.439	regulation of cellular metabolic process
GO:0051171	0.438	regulation of nitrogen compound metabolic process
GO:0051641	0.424	cellular localization
GO:0006950	0.423	response to stress
GO:0009653	0.419	anatomical structure morphogenesis
GO:0051235	0.418	maintenance of location
GO:0050793	0.412	regulation of developmental process
GO:0009991	0.384	response to extracellular stimulus
GO:0009968	0.347	negative regulation of signal transduction
GO:0008152	0.343	metabolic process
GO:0017015	0.318	regulation of transforming growth factor beta receptor signaling pathway
GO:0033993	0.307	response to lipid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.986	extracellular region
GO:0043226	0.975	organelle
GO:0043227	0.971	membrane-bounded organelle
GO:0099080	0.967	supramolecular complex
GO:0005622	0.962	intracellular anatomical structure
GO:0012505	0.942	endomembrane system
GO:0070013	0.931	intracellular organelle lumen
GO:0005737	0.909	cytoplasm
GO:0043231	0.908	intracellular membrane-bounded organelle
GO:0099081	0.877	supramolecular polymer
GO:0005615	0.865	extracellular space
GO:0099512	0.862	supramolecular fiber
GO:0001527	0.781	microfibril
GO:0032991	0.752	protein-containing complex
GO:0005788	0.482	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]