StarFunc result for job id Q14767

User Input

>input (1821 residues)
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRYEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVQPPAQ
TRRSTPLGQQQPAPRTRAAPALPRLGTPQRSGAAPPTPPRGRLTGRNVCGGQCCPGWTTA
NSTNHCIKPVCEPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRRWA
ERSPNLRRSSAAGEGTLARAQPPAPQSPPAPQSPPAGTLSGLSQTHPSQQHVGLSRTVRL
HPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIVFTPTIC
KQTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPA
NSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVHIHH
PPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPPRPL
PPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPASPV
IENGQLECPQGYKRLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPSRSR
CVSDKAISMLQGLCYRSLGPGTCTLPLAQRITKQICCCSRVGKAWGSECEKCPLPGTEAF
REICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVTDTW
LEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIAEIQEEQVTPSTDVLVTL
STPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCKGKG
RCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCSGGQCTNTEGSYHCECDQGY
IMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTPGVC
AHGKCTNLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPTGLCLNTEGSFACSACEN
GYWVNEDGTACEDLDECAFPGVCPSGVCTNTAGSFSCKDCDGGYRPSPLGDSCEDVDECE
DPQSSCLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFF
CLCAPGFVSAEGGTSCQDVDECATTDPCVGGHCVNTEGSFNCLCETGFQPSPESGECVDI
DECEDYGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECANDTMCGSHGFCD
NTDGSFRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYD
AQEGHCRPRGAGGQSMSEAPTGDHAPAPTRMDCYSGQKGHAPCSSVLGRNTTQAECCCTQ
GASWGDACDLCPSEDSAEFSEICPSGKGYIPVEGAWTFGQTMYTDADECVIFGPGLCPNG
RCLNTVPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLD
LSQQRCMNSTSSTEDLPDHDIHMDICWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQ
CALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYL
GPEDTVPEPAFPNTAGHSADRTPILESPLQPSELQPHYVASHPEPPAGFEGLQAEECGIL
NGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSY
RCHCSPGYVAEAGPPHCTAKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14767	1.000	1.000	0.000	1821	1.000	1.000	Q14767.pdb.gz	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
2	AFDB:Q8CG19	0.107	0.113	0.000	1712	0.390	0.415	Q8CG19.pdb.gz	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
3	PDB:7q3nU	0.057	0.243	4.041E-7	292	0.031	0.195	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
4	AFDB:Q9ULI3	0.045	0.057	4.319E-6	1381	0.098	0.129	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
5	AFDB:E9Q7X6	0.048	0.063	7.077E-6	1337	0.109	0.148	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
6	AFDB:Q6R8J2	0.042	0.073	4.831E-5	977	0.085	0.158	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
7	AFDB:P25653	0.042	0.045	1.807E-3	1609	0.127	0.144	P25653.pdb.gz	FIG2_YEAST Factor-induced gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG2 PE=1 SV=2
8	AFDB:Q04164	0.044	0.046	5.126E-3	1693	0.115	0.124	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
9	AFDB:A1Z6W9	0.047	0.058	6.744E-3	1363	0.126	0.168	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
10	AFDB:P55066	0.044	0.060	7.527E-3	1268	0.091	0.130	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
11	AFDB:Q867Z4	0.035	0.049	7.527E-3	970	0.072	0.135	Q867Z4.pdb.gz	LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1
12	PDB:3b4vD	0.042	0.164	2.493E-2	213	0.021	0.178	3b4vD.pdb.gz
13	PDB:7n9qA	0.055	0.048	3.661E-2	2315	0.035	0.027	7n9qA.pdb.gz
14	PDB:7nycC	0.036	0.061	4.086E-2	809	0.031	0.070	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
15	PDB:4e0sB	0.027	0.043	6.695E-2	898	0.021	0.043	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
16	PDB:3t5oA	0.030	0.057	9.831E-2	871	0.032	0.068	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:6pyhD	0.023	0.041	1.615	798	0.016	0.038	6pyhD.pdb.gz
18	PDB:7epaA	0.024	0.041	1.802	782	0.009	0.022	7epaA.pdb.gz
19	PDB:7p2eH	0.018	0.123	2.011	140	0.009	0.121	7p2eH.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
20	PDB:2vldA	0.024	0.106	2.504	228	0.010	0.079	2vldA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7YY58	0.0	697	1338	0.224	0.305	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
2	B7ZLY3	0.0	660	1353	0.208	0.279	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
3	F1MF86	0.0	3056	1963	0.850	0.789	F1MF86_BOVIN Latent transforming growth factor beta binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=4 SV=1
4	O08999	0.0	2897	1813	0.798	0.801	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
5	Q00918	0.0	1093	1712	0.387	0.412	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
6	Q14766	0.0	1080	1721	0.377	0.399	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
7	Q14767	0.0	3693	1821	1.000	1.000	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
8	Q28019	0.0	3051	1842	0.849	0.839	LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2
9	Q61810	0.0	610	1253	0.253	0.367	LTBP3_MOUSE Latent-transforming growth factor beta-binding protein 3 OS=Mus musculus OX=10090 GN=Ltbp3 PE=1 SV=4
10	Q8CG19	0.0	1078	1712	0.389	0.414	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
11	Q8K4G1	0.0	920	1666	0.340	0.372	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
12	Q8N2S1	0.0	895	1624	0.336	0.377	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
13	Q9NS15	0.0	633	1303	0.258	0.361	LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens OX=9606 GN=LTBP3 PE=1 SV=4
14	Q61554	6.85e-120	424	2873	0.217	0.137	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
15	P35555	1.44e-119	423	2871	0.218	0.138	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
16	G3V9M6	1.34e-118	421	2872	0.217	0.138	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
17	Q9WUH8	1.05e-117	417	2872	0.216	0.137	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
18	A0A8I6G7Y9	2.39e-116	413	2861	0.198	0.126	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
19	P35556	6.00e-116	412	2912	0.220	0.138	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
20	P98133	4.32e-115	409	2871	0.188	0.119	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.7e-77	266.1	Complement Clr-like EGF-like
2	PF00008 EGF	3.5e-25	99.3	EGF-like domain
3	PF07974 EGF_2	22	16.8	EGF-like domain
4	PF12947 EGF_3	5.2e-22	89.0	EGF domain
5	PF07645 EGF_CA	9.2e-112	376.3	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	1.1e-13	62.5	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	1.4e-19	81.1	Human growth factor-like EGF
8	PF00683 TB	4.3e-34	127.3	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260950	0.702	Growth/differentiation factor 8
2	9606.ENSP00000351807	0.694	Elastin
3	9606.ENSP00000037502	0.669	Myocilin
4	9606.ENSP00000371211	0.659	Transmembrane protease serine 6
5	9606.ENSP00000263277	0.643	EH domain-containing protein 2
6	9606.ENSP00000478561	0.642	Cytochrome P450 1B1
7	9606.ENSP00000261921	0.637	Lysyl oxidase homolog 1
8	9606.ENSP00000381782	0.629	Solute carrier family 25 member 45
9	9606.ENSP00000270328	0.615	A disintegrin and metalloproteinase with thrombospondin motifs 10
10	9606.ENSP00000432568	0.613	Spectrin beta chain, non-erythrocytic 2
11	9606.ENSP00000263373	0.605	Spectrin beta chain, non-erythrocytic 4
12	9606.ENSP00000355245	0.604	Paired box protein Pax-9
13	9606.ENSP00000355896	0.603	Transforming growth factor beta-2
14	9606.ENSP00000221930	0.584	Transforming growth factor beta-1
15	9606.ENSP00000364685	0.573	Microfibrillar-associated protein 2
16	9606.ENSP00000387050	0.568	Phospholipase D3
17	9606.ENSP00000345008	0.559	Fibulin-5
18	9606.ENSP00000346478	0.556	ADAMTS-like protein 2
19	9606.ENSP00000423067	0.541	WD repeat-containing protein 36
20	9606.ENSP00000358730	0.539	Transmembrane domain-containing protein TMIGD3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.973	response to stimulus
GO:0051716	0.844	cellular response to stimulus
GO:0071840	0.685	cellular component organization or biogenesis
GO:0016043	0.684	cellular component organization
GO:0097435	0.670	supramolecular fiber organization
GO:0007154	0.652	cell communication
GO:0023052	0.646	signaling
GO:0007165	0.633	signal transduction
GO:0048856	0.493	anatomical structure development
GO:0032501	0.412	multicellular organismal process
GO:0007275	0.361	multicellular organism development
GO:0051179	0.359	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.999	extracellular matrix
GO:0005576	0.987	extracellular region
GO:0043226	0.974	organelle
GO:0043227	0.952	membrane-bounded organelle
GO:0062023	0.942	collagen-containing extracellular matrix
GO:0031982	0.888	vesicle
GO:0043230	0.877	extracellular organelle
GO:1903561	0.855	extracellular vesicle
GO:0005615	0.799	extracellular space
GO:0005622	0.762	intracellular anatomical structure
GO:0043231	0.677	intracellular membrane-bounded organelle
GO:0070062	0.670	extracellular exosome
GO:0005737	0.553	cytoplasm
GO:0099081	0.467	supramolecular polymer
GO:0099512	0.457	supramolecular fiber
GO:0001527	0.397	microfibril

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]