StarFunc result for job id Q14774

User Input

>input (488 residues)
MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAA
PEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYH
HHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDR
ILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPL
NSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKY
VTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADG
EQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS
AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEP
AQGALGCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14774	0.999	0.999	2.666E-69	488	1.000	1.000	Q14774.pdb.gz	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
2	AFDB:Q61670	0.341	0.347	1.316E-55	476	0.865	0.887	Q61670.pdb.gz	HLX_MOUSE H2.0-like homeobox protein OS=Mus musculus OX=10090 GN=Hlx PE=2 SV=1
3	AFDB:A6NMT0	0.143	0.200	8.552E-9	343	0.209	0.297	A6NMT0.pdb.gz	DBX1_HUMAN Homeobox protein DBX1 OS=Homo sapiens OX=9606 GN=DBX1 PE=3 SV=2
4	AFDB:P50219	0.178	0.213	8.591E-8	401	0.193	0.234	P50219.pdb.gz	MNX1_HUMAN Motor neuron and pancreas homeobox protein 1 OS=Homo sapiens OX=9606 GN=MNX1 PE=1 SV=3
5	AFDB:Q7PL95	0.166	0.172	1.041E-7	468	0.166	0.173	Q7PL95.pdb.gz	Q7PL95_DROME Scarecrow, isoform A OS=Drosophila melanogaster OX=7227 GN=scro PE=4 SV=1
6	AFDB:Q9QZW9	0.189	0.222	1.110E-7	404	0.182	0.220	Q9QZW9.pdb.gz	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
7	AFDB:P09085	0.131	0.148	2.395E-7	427	0.176	0.201	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
8	AFDB:O18400	0.170	0.164	6.263E-7	509	0.184	0.177	O18400.pdb.gz	PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster OX=7227 GN=Ptx1 PE=2 SV=2
9	AFDB:Q8H991	0.145	0.093	1.046E-6	792	0.133	0.082	Q8H991.pdb.gz	HAZ1_ORYSJ Homeobox protein HAZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=HAZ1 PE=2 SV=1
10	AFDB:Q99626	0.146	0.221	1.746E-6	313	0.160	0.249	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
11	PDB:4egcA	0.102	0.092	5.509E-3	539	0.033	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.111	0.632	2.735E-2	73	0.037	0.247	2hi3A.pdb.gz
13	PDB:7fbyA	0.080	0.227	8.706E-1	153	0.010	0.033	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cg4A	0.083	0.247	1.652	149	0.016	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:7dcoL	0.080	0.088	1.652	435	0.041	0.046	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:5z56L	0.071	0.098	2.003	342	0.027	0.038	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:2cyyA	0.079	0.217	2.135	151	0.018	0.060	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
18	PDB:5aj0BZ	0.088	0.412	2.427	86	0.018	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:7awtE	0.060	0.162	2.427	156	0.016	0.051	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:2cjjA	0.106	0.682	2.588	63	0.018	0.143	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14774	0.0	979	488	1.000	1.000	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
2	Q61670	0.0	723	476	0.865	0.887	HLX_MOUSE H2.0-like homeobox protein OS=Mus musculus OX=10090 GN=Hlx PE=2 SV=1
3	Q6NY96	2.69e-106	321	327	0.402	0.599	Q6NY96_DANRE H2.0-like homeo box 1 (Drosophila) OS=Danio rerio OX=7955 GN=fa28a07 PE=2 SV=1
4	Q9PTU1	1.10e-23	103	314	0.102	0.159	DBX1A_DANRE Homeobox protein DBX1-A OS=Danio rerio OX=7955 GN=dbx1a PE=2 SV=1
5	A6NMT0	3.60e-23	102	343	0.090	0.128	DBX1_HUMAN Homeobox protein DBX1 OS=Homo sapiens OX=9606 GN=DBX1 PE=3 SV=2
6	P52950	4.56e-23	102	335	0.088	0.128	DBX1_MOUSE Homeobox protein DBX1 OS=Mus musculus OX=10090 GN=Dbx1 PE=2 SV=1
7	Q9W064	6.93e-23	104	741	0.092	0.061	Q9W064_DROME Dbx OS=Drosophila melanogaster OX=7227 GN=Dbx PE=4 SV=2
8	Q9PTU0	1.34e-22	100	322	0.088	0.134	DBX1B_DANRE Homeobox protein DBX1-B OS=Danio rerio OX=7955 GN=dbx1b PE=2 SV=1
9	E1BS07	2.91e-22	100	403	0.090	0.109	E1BS07_CHICK Leucine twenty homeobox OS=Gallus gallus OX=9031 GN=LEUTX PE=4 SV=3
10	Q6ZNG2	7.79e-21	95.5	339	0.090	0.130	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
11	Q810B3	6.95e-18	85.1	232	0.092	0.194	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
12	Q9UMQ3	1.57e-17	85.1	279	0.141	0.247	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
13	O08686	1.91e-17	84.7	283	0.102	0.177	BARX2_MOUSE Homeobox protein BarH-like 2 OS=Mus musculus OX=10090 GN=Barx2 PE=2 SV=2
14	Q503F2	2.41e-17	83.6	248	0.080	0.157	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
15	Q3C1V8	5.71e-17	82.4	233	0.086	0.180	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
16	Q05502	6.17e-17	83.2	277	0.102	0.181	HHEX_CHICK Hematopoietically-expressed homeobox protein HHEX OS=Gallus gallus OX=9031 GN=HHEX PE=1 SV=1
17	Q03014	8.64e-17	82.4	270	0.078	0.141	HHEX_HUMAN Hematopoietically-expressed homeobox protein HHEX OS=Homo sapiens OX=9606 GN=HHEX PE=1 SV=1
18	Q6R3Q6	1.01e-16	81.3	227	0.080	0.172	BSH_DANRE Brain-specific homeobox protein homolog OS=Danio rerio OX=7955 GN=bsx PE=2 SV=1
19	Q9ER42	2.18e-16	81.3	254	0.074	0.142	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
20	O13023	2.29e-16	81.3	272	0.078	0.140	HHEX_XENLA Hematopoietically-expressed homeobox protein hhex OS=Xenopus laevis OX=8355 GN=hhex PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	79	14.6	Homeobox KN domain
2	PF00046 Homeodomain	1.8e-16	71.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355870

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376134	0.937	Signal transducer and activator of transcription 4
2	9606.ENSP00000177694	0.871	T-box transcription factor TBX21
3	9606.ENSP00000363993	0.769	Proteasome subunit beta type-9
4	9606.ENSP00000355904	0.734	Estrogen-related receptor gamma
5	9606.ENSP00000466542	0.699	Transducin-like enhancer protein 2
6	9606.ENSP00000365720	0.675	Transducin-like enhancer protein 4
7	9606.ENSP00000365682	0.674	Transducin-like enhancer protein 1
8	9606.ENSP00000261888	0.650	Mono [ADP-ribose] polymerase PARP16
9	9606.ENSP00000355896	0.605	Transforming growth factor beta-2
10	9606.ENSP00000422488	0.566	Steroid hormone receptor ERR2
11	9606.ENSP00000380516	0.560	Homeobox-containing protein 1
12	9606.ENSP00000168216	0.546	3-hydroxyacyl-CoA dehydrogenase type-2
13	9606.ENSP00000320147	0.538	Histone-lysine N-methyltransferase EZH2
14	9606.ENSP00000429553	0.532	Homeobox protein Nkx-6.3
15	9606.ENSP00000296682	0.522	Histone-lysine N-methyltransferase PRDM9
16	9606.ENSP00000257829	0.520	RNA cytidine acetyltransferase
17	9606.ENSP00000221561	0.507	Amino-terminal enhancer of split
18	9606.ENSP00000397927	0.502	Polymerase delta-interacting protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:1990837	0.962	sequence-specific double-stranded DNA binding
GO:0003700	0.955	DNA-binding transcription factor activity
GO:0000981	0.791	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.685	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.961	response to stimulus
GO:0019222	0.833	regulation of metabolic process
GO:0060255	0.823	regulation of macromolecule metabolic process
GO:0031323	0.816	regulation of cellular metabolic process
GO:0080090	0.815	regulation of primary metabolic process
GO:0051171	0.815	regulation of nitrogen compound metabolic process
GO:0051716	0.789	cellular response to stimulus
GO:0010468	0.770	regulation of gene expression
GO:0010556	0.761	regulation of macromolecule biosynthetic process
GO:0031326	0.761	regulation of cellular biosynthetic process
GO:0019219	0.760	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.714	positive regulation of biological process
GO:0048519	0.700	negative regulation of biological process
GO:0007154	0.686	cell communication
GO:0023052	0.678	signaling
GO:0032502	0.666	developmental process
GO:0006355	0.662	regulation of DNA-templated transcription
GO:0048522	0.627	positive regulation of cellular process
GO:0048523	0.616	negative regulation of cellular process
GO:0048856	0.612	anatomical structure development
GO:0010604	0.545	positive regulation of macromolecule metabolic process
GO:0007165	0.530	signal transduction
GO:0007275	0.500	multicellular organism development
GO:0048731	0.477	system development
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0031325	0.431	positive regulation of cellular metabolic process
GO:0048513	0.424	animal organ development
GO:0006357	0.422	regulation of transcription by RNA polymerase II
GO:0010557	0.385	positive regulation of macromolecule biosynthetic process
GO:0031328	0.385	positive regulation of cellular biosynthetic process
GO:0045935	0.328	positive regulation of nucleobase-containing compound metabolic process
GO:0009892	0.307	negative regulation of metabolic process
GO:0031324	0.304	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005654	0.981	nucleoplasm
GO:0032991	0.919	protein-containing complex
GO:0005737	0.674	cytoplasm
GO:0005829	0.425	cytosol
GO:0005667	0.403	transcription regulator complex
GO:0016020	0.377	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]