StarFunc result for job id Q14789

User Input

>input (1400 residues)
MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQL
VVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGT
VLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEELISTLQAQLTQAQAEQPAQSST
EMEEFVMMKQQLQEKEEFISTLQAQLSQTQAEQAAQQVVREKDARFETQVRLHEDELLQL
VTQADVETEMQQKLRVLQRKLEEHEESLVGRAQVVDLLQQELTAAEQRNQILSQQLQQME
AEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELE
SRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTI
QQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQKRVVEL
ENEKGALLLSSIELEELKAENEKLSSQITLLEAQNRTGEADREVSEISIVDIANKRSSSA
EESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFLKLQLQGKRAEEADHEVLDQKEMKQ
MEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVEKEQASTEHQSRTSEEISLNDAGVE
LKSTKQDGDKSLSAVPDIGQCHQDELERLKSQILELELNFHKAQEIYEKNLDEKAKEISN
LNQLIEEFKKNADNNSSAFTALSEERDQLLSQVKELSMVTELRAQVKQLEMNLAEAERQR
RLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQNELDDVQLQFSEQSTLIRSLQSQL
QNKESEVLEGAERVRHISSKVEELSQALSQKELEITKMDQLLLEKKRDVETLQQTIEEKD
QQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLNLLSRAEEAKKEQVEEDNEVSSGLK
QNYDEMSPAGQISKEELQHEFDLLKKENEQRKRKLQAALINRKELLQRVSRLEEELANLK
DESKKEIPLSETERGEVEEDKENKEYSEKCVTSKCQEIEIYLKQTISEKEVELQHIRKDL
EEKLAAEEQFQALVKQMNQTLQDKTNQIDLLQAEISENQAIIQKLITSNTDASDGDSVAL
VKETVVISPPCTGSSEHWKPELEEKILALEKEKEQLQKKLQEALTSRKAILKKAQEKERH
LREELKQQKDDYNRLQEQFDEQSKENENIGDQLRQLQIQVRESIDGKLPSTDQQESCSST
PGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIKAQLKEIEAEKVE
LELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESLKTVSHEAEVHAESLQQKLESSQLQ
IAGLEHLRELQPKLDELQKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZNF9	0.159	0.240	6.984E-40	893	0.344	0.540	B7ZNF9.pdb.gz	B7ZNF9_MOUSE Golgb1 protein OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
2	AFDB:Q80YT7	0.085	0.057	1.381E-5	2224	0.155	0.098	Q80YT7.pdb.gz	MYOME_MOUSE Myomegalin OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=2
3	AFDB:Q9D4H4	0.070	0.094	1.624E-3	968	0.090	0.130	Q9D4H4.pdb.gz	AMOL1_MOUSE Angiomotin-like protein 1 OS=Mus musculus OX=10090 GN=Amotl1 PE=1 SV=2
4	AFDB:Q5VU43	0.076	0.049	3.504E-3	2346	0.159	0.095	Q5VU43.pdb.gz	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
5	AFDB:Q9WUJ3	0.074	0.047	4.086E-3	2324	0.158	0.095	Q9WUJ3.pdb.gz	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
6	AFDB:Q9QYP6	0.063	0.190	4.766E-3	405	0.054	0.188	Q9QYP6.pdb.gz	AZI2_MOUSE 5-azacytidine-induced protein 2 OS=Mus musculus OX=10090 GN=Azi2 PE=1 SV=1
7	AFDB:Q8I7C3	0.036	0.068	6.002E-3	657	0.026	0.056	Q8I7C3.pdb.gz	LASP1_DROME LIM and SH3 domain protein Lasp OS=Drosophila melanogaster OX=7227 GN=Lasp PE=1 SV=2
8	AFDB:H2L2D1	0.035	0.049	1.110E-2	947	0.031	0.046	H2L2D1.pdb.gz	H2L2D1_CAEEL guanylate cyclase OS=Caenorhabditis elegans OX=6239 GN=gcy-33 PE=1 SV=1
9	AFDB:Q386I1	0.059	0.084	1.110E-2	932	0.071	0.106	Q386I1.pdb.gz	Q386I1_TRYB2 Centromere protein J C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0810 PE=3 SV=1
10	AFDB:Q32PN7	0.088	0.144	1.510E-2	756	0.067	0.124	Q32PN7.pdb.gz	DZI1L_DANRE Cilium assembly protein DZIP1L OS=Danio rerio OX=7955 GN=dzip1l PE=2 SV=1
11	PDB:7mqaNA	0.023	0.096	9.349	295	0.022	0.105	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWG6	0.0	1394	3008	0.582	0.271	A0A0G2JWG6_RAT Golgin B1 OS=Rattus norvegicus OX=10116 GN=Golgb1 PE=1 SV=2
2	A0A8I5ZUB6	0.0	1571	3185	0.666	0.293	A0A8I5ZUB6_RAT Golgin B1 OS=Rattus norvegicus OX=10116 GN=Golgb1 PE=1 SV=1
3	A0A8I6AFX2	0.0	1326	2978	0.558	0.262	A0A8I6AFX2_RAT Golgin B1 OS=Rattus norvegicus OX=10116 GN=Golgb1 PE=1 SV=1
4	B2RWW2	0.0	1690	3238	0.699	0.302	B2RWW2_MOUSE Golgb1 protein OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
5	B7ZNF9	0.0	719	893	0.296	0.464	B7ZNF9_MOUSE Golgb1 protein OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
6	E7EU81	0.0	2663	3223	0.974	0.423	E7EU81_HUMAN Golgin B1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2
7	E9PVZ8	0.0	1693	3238	0.699	0.302	E9PVZ8_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
8	E9QAH1	0.0	1612	3197	0.674	0.295	E9QAH1_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
9	G3V6A8	0.0	1579	3187	0.668	0.293	G3V6A8_RAT Golgin B1 OS=Rattus norvegicus OX=10116 GN=Golgb1 PE=1 SV=1
10	Q14789	0.0	2754	3259	1.000	0.430	GOGB1_HUMAN Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2
11	Q63714	0.0	1575	3187	0.666	0.293	Q63714_RAT Rat GCP360 OS=Rattus norvegicus OX=10116 GN=Golgb1 PE=2 SV=1
12	Q9CTU9	1.42e-55	191	146	0.076	0.726	Q9CTU9_MOUSE Golgi autoantigen, golgin subfamily b, macrogolgin 1 (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=1 SV=1
13	Q3U289	1.03e-54	189	146	0.075	0.719	Q3U289_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
14	Q571K1	2.11e-15	84.7	1916	0.031	0.023	Q571K1_MOUSE MKIAA4151 protein (Fragment) OS=Mus musculus OX=10090 GN=Golgb1 PE=2 SV=1
15	Q57UV7	0.34	38.1	1456	0.035	0.034	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
16	B3RH40	1.9	35.4	1255	0.018	0.020	B3RH40_MEDTR Myosin heavy chain-like protein, putative OS=Medicago truncatula OX=3880 GN=25484843 PE=4 SV=1
17	P08553	2.6	35.0	848	0.042	0.070	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
18	H0Y6I0	2.9	35.0	2250	0.042	0.026	H0Y6I0_HUMAN Golgi autoantigen, golgin subfamily a, 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=2
19	Q13439	3.6	34.7	2230	0.042	0.026	GOGA4_HUMAN Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1
20	Q6ZQ06	4.5	34.3	1403	0.031	0.031	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	31	16.2	Autophagy protein 16 (ATG16)
2	PF13801 Metal_resist	1.4	20.6	Heavy-metal resistance
3	PF12329 TMF_DNA_bd	31	16.0	TATA element modulatory factor 1 DNA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377275

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355777	0.996	Golgi resident protein GCP60
2	9606.ENSP00000416097	0.996	Golgin subfamily A member 2
3	9606.ENSP00000444850	0.983	General vesicular transport factor p115
4	9606.ENSP00000313869	0.935	Golgi reassembly-stacking protein 1
5	9606.ENSP00000358548	0.909	GTPase NRas
6	9606.ENSP00000407586	0.904	GTPase HRas
7	9606.ENSP00000256078	0.902	GTPase KRas
8	9606.ENSP00000267622	0.859	Thyroid receptor-interacting protein 11
9	9606.ENSP00000387286	0.853	Ras-related protein Rab-1A
10	9606.ENSP00000311449	0.847	Ras-related protein Rab-6A
11	9606.ENSP00000329419	0.835	Coatomer subunit beta
12	9606.ENSP00000305442	0.831	Conserved oligomeric Golgi complex subunit 7
13	9606.ENSP00000386443	0.825	Trans-Golgi network integral membrane protein 2
14	9606.ENSP00000305459	0.818	Conserved oligomeric Golgi complex subunit 8
15	9606.ENSP00000315775	0.814	Conserved oligomeric Golgi complex subunit 4
16	9606.ENSP00000258654	0.811	Conserved oligomeric Golgi complex subunit 3
17	9606.ENSP00000355629	0.805	Conserved oligomeric Golgi complex subunit 2
18	9606.ENSP00000349305	0.798	Golgin subfamily A member 4
19	9606.ENSP00000251047	0.793	Protein ERGIC-53
20	9606.ENSP00000299886	0.777	Conserved oligomeric Golgi complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007030	0.920	Golgi organization
GO:0044380	0.797	protein localization to cytoskeleton
GO:0072698	0.705	protein localization to microtubule cytoskeleton
GO:1905508	0.696	protein localization to microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.813	membrane
GO:0031090	0.599	organelle membrane
GO:0098588	0.567	bounding membrane of organelle
GO:0000139	0.422	Golgi membrane
GO:0005829	0.336	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]