StarFunc result for job id Q14790

User Input

>input (479 residues)
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14790	1.000	1.000	3.612E-95	479	1.000	1.000	Q14790.pdb.gz	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
2	AFDB:O89110	0.643	0.642	2.220E-71	480	0.670	0.669	O89110.pdb.gz	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
3	AFDB:Q9JHX4	0.674	0.670	1.377E-69	482	0.658	0.654	Q9JHX4.pdb.gz	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
4	AFDB:A0A2U9DQK9	0.475	0.477	2.602E-46	477	0.399	0.400	A0A2U9DQK9.pdb.gz
5	AFDB:H7C0E2	0.445	0.822	2.891E-42	258	0.532	0.988	H7C0E2.pdb.gz	H7C0E2_HUMAN Caspase-8 (Fragment) OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
6	AFDB:Q92851	0.384	0.354	2.256E-38	521	0.340	0.313	Q92851.pdb.gz	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
7	AFDB:H0Z8H6	0.457	0.768	9.610E-30	282	0.225	0.383	H0Z8H6.pdb.gz	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
8	AFDB:O93417	0.472	0.784	1.019E-29	283	0.211	0.357	O93417.pdb.gz	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
9	AFDB:O15519	0.619	0.618	1.540E-29	480	0.280	0.279	O15519.pdb.gz	CFLAR_HUMAN CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1
10	AFDB:A0A288CG41	0.462	0.505	4.197E-29	437	0.209	0.229	A0A288CG41.pdb.gz	A0A288CG41_DANRE Caspase 2 OS=Danio rerio OX=7955 GN=casp2 PE=2 SV=1
11	PDB:4fdlB	0.458	0.902	4.107E-27	239	0.203	0.406	4fdlB.pdb.gz
12	PDB:4pryA	0.466	0.879	1.187E-26	249	0.198	0.382	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
13	PDB:5jqeA	0.370	0.326	1.412E-25	544	0.372	0.327	5jqeA.pdb.gz
14	PDB:4nblA	0.441	0.798	3.204E-23	258	0.186	0.345	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
15	PDB:7wzsB	0.385	0.869	9.176E-20	206	0.184	0.427	7wzsB.pdb.gz
16	PDB:4iyrB	0.371	0.913	3.347E-18	191	0.154	0.387	4iyrB.pdb.gz
17	PDB:2wdpD	0.380	0.761	5.690E-18	230	0.171	0.357	2wdpD.pdb.gz
18	PDB:2bbzA	0.320	0.752	1.691E-7	190	0.090	0.226	2bbzA.pdb.gz
19	PDB:4af8A	0.298	0.407	5.798E-5	333	0.069	0.099	4af8A.pdb.gz
20	PDB:5nijA	0.309	0.341	6.920E-5	428	0.052	0.058	5nijA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O89110	0.0	651	480	0.683	0.681	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
2	Q14790	0.0	986	479	1.000	1.000	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
3	Q9JHX4	0.0	629	482	0.664	0.660	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
4	Q6NVI2	2.64e-176	497	278	0.528	0.910	Q6NVI2_HUMAN CASP8 protein OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
5	H7C0E2	1.48e-159	454	258	0.443	0.822	H7C0E2_HUMAN Caspase-8 (Fragment) OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
6	Q66I19	2.71e-99	308	476	0.411	0.414	Q66I19_DANRE Caspase 8, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=zgc:92075 PE=1 SV=1
7	Q92851	7.14e-73	241	521	0.344	0.317	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
8	P97864	1.45e-52	181	303	0.221	0.350	CASP7_MOUSE Caspase-7 OS=Mus musculus OX=10090 GN=Casp7 PE=1 SV=2
9	H0Z8H6	4.13e-52	179	282	0.230	0.390	H0Z8H6_TAEGU Caspase 3 OS=Taeniopygia guttata OX=59729 GN=CASP3 PE=3 SV=2
10	F1NV61	9.19e-51	177	309	0.219	0.340	CASP7_CHICK Caspase-7 OS=Gallus gallus OX=9031 GN=CASP7 PE=3 SV=2
11	A0A0G2K9Z4	9.68e-50	173	291	0.225	0.371	A0A0G2K9Z4_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=1 SV=1
12	A0A8I5ZQU7	1.85e-49	173	301	0.225	0.359	A0A8I5ZQU7_RAT Caspase 7 OS=Rattus norvegicus OX=10116 GN=Casp7 PE=3 SV=1
13	O93417	2.14e-48	169	283	0.217	0.367	O93417_CHICK Caspase-3 OS=Gallus gallus OX=9031 GN=CASP3 PE=1 SV=1
14	Q98UI8	2.54e-47	167	282	0.215	0.365	Q98UI8_DANRE Caspase 3, apoptosis-related cysteine peptidase a OS=Danio rerio OX=7955 GN=casp3 PE=1 SV=1
15	Q4ZHV0	6.27e-47	166	279	0.205	0.351	Q4ZHV0_SALSA Caspase 3B OS=Salmo salar OX=8030 GN=CASP3 PE=2 SV=1
16	G3IL63	6.78e-47	166	303	0.219	0.347	G3IL63_CRIGR Caspase-7 OS=Cricetulus griseus OX=10029 GN=I79_024625 PE=1 SV=1
17	P55210	4.39e-46	164	303	0.209	0.330	CASP7_HUMAN Caspase-7 OS=Homo sapiens OX=9606 GN=CASP7 PE=1 SV=1
18	P55213	1.83e-45	162	277	0.207	0.357	CASP3_RAT Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2
19	P42574	1.97e-45	161	277	0.207	0.357	CASP3_HUMAN Caspase-3 OS=Homo sapiens OX=9606 GN=CASP3 PE=1 SV=2
20	P70677	3.46e-45	161	277	0.205	0.354	CASP3_MOUSE Caspase-3 OS=Mus musculus OX=10090 GN=Casp3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01335 DED	5.1e-41	150.0	Death effector domain
2	PF00656 Peptidase_C14	7.9e-36	135.5	Caspase domain
3	PF02758 PYRIN	1.2e+02	14.2	PAAD/DAPIN/Pyrin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000216274	0.999	Receptor-interacting serine/threonine-protein kinase 3
3	9606.ENSP00000221132	0.999	Tumor necrosis factor receptor superfamily member 10A
4	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000276431	0.999	Tumor necrosis factor receptor superfamily member 10B
6	9606.ENSP00000301838	0.999	FAS-associated death domain protein
7	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
8	9606.ENSP00000347979	0.999	Tumor necrosis factor receptor superfamily member 6
9	9606.ENSP00000356694	0.999	Tumor necrosis factor ligand superfamily member 6
10	9606.ENSP00000241261	0.998	Tumor necrosis factor ligand superfamily member 10
11	9606.ENSP00000312455	0.998	CASP8 and FADD-like apoptosis regulator
12	9606.ENSP00000359612	0.998	B-cell lymphoma/leukemia 10
13	9606.ENSP00000477613	0.997	Baculoviral IAP repeat-containing protein 2
14	9606.ENSP00000247668	0.995	TNF receptor-associated factor 2
15	9606.ENSP00000433623	0.995	TNF receptor-associated factor 6
16	9606.ENSP00000318822	0.994	BH3-interacting domain death agonist
17	9606.ENSP00000379457	0.994	FAS-associated factor 1
18	9606.ENSP00000483825	0.994	NF-kappa-B essential modulator
19	9606.ENSP00000319279	0.992	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
20	9606.ENSP00000374455	0.991	Sequestosome-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044389	1.000	ubiquitin-like protein ligase binding
GO:0019904	0.999	protein domain specific binding
GO:0097153	0.999	cysteine-type endopeptidase activity involved in apoptotic process
GO:0042802	0.997	identical protein binding
GO:0031625	0.982	ubiquitin protein ligase binding
GO:0097110	0.897	scaffold protein binding
GO:0005102	0.528	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0048522	0.990	positive regulation of cellular process
GO:0048583	0.987	regulation of response to stimulus
GO:0023051	0.986	regulation of signaling
GO:0010646	0.986	regulation of cell communication
GO:0006915	0.986	apoptotic process
GO:0051716	0.983	cellular response to stimulus
GO:0044238	0.978	primary metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0080090	0.976	regulation of primary metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0023056	0.969	positive regulation of signaling
GO:0010647	0.969	positive regulation of cell communication
GO:0009966	0.967	regulation of signal transduction
GO:0043122	0.964	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0019538	0.961	protein metabolic process
GO:0042221	0.954	response to chemical
GO:0007154	0.953	cell communication
GO:0048584	0.951	positive regulation of response to stimulus
GO:0006508	0.945	proteolysis
GO:0023052	0.944	signaling
GO:0042981	0.939	regulation of apoptotic process
GO:0010942	0.939	positive regulation of cell death
GO:0043123	0.938	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032501	0.934	multicellular organismal process
GO:0016485	0.931	protein processing
GO:0007165	0.925	signal transduction
GO:2000116	0.922	regulation of cysteine-type endopeptidase activity
GO:0043068	0.920	positive regulation of programmed cell death
GO:0032502	0.897	developmental process
GO:0010939	0.891	regulation of necrotic cell death
GO:0048856	0.888	anatomical structure development
GO:0097190	0.877	apoptotic signaling pathway
GO:0051345	0.875	positive regulation of hydrolase activity
GO:0045862	0.871	positive regulation of proteolysis
GO:0043065	0.860	positive regulation of apoptotic process
GO:0001817	0.827	regulation of cytokine production
GO:0010033	0.818	response to organic substance
GO:0010952	0.809	positive regulation of peptidase activity
GO:0010628	0.806	positive regulation of gene expression
GO:0002682	0.800	regulation of immune system process
GO:2001056	0.796	positive regulation of cysteine-type endopeptidase activity
GO:0002684	0.765	positive regulation of immune system process
GO:0048519	0.764	negative regulation of biological process
GO:0007275	0.764	multicellular organism development
GO:0007166	0.758	cell surface receptor signaling pathway
GO:0048523	0.739	negative regulation of cellular process
GO:0009968	0.687	negative regulation of signal transduction
GO:0009605	0.671	response to external stimulus
GO:0030154	0.658	cell differentiation
GO:0097191	0.641	extrinsic apoptotic signaling pathway
GO:0001959	0.621	regulation of cytokine-mediated signaling pathway
GO:0051240	0.619	positive regulation of multicellular organismal process
GO:0008625	0.619	extrinsic apoptotic signaling pathway via death domain receptors
GO:0009628	0.586	response to abiotic stimulus
GO:0009612	0.567	response to mechanical stimulus
GO:0031323	0.563	regulation of cellular metabolic process
GO:0071214	0.559	cellular response to abiotic stimulus
GO:0097194	0.543	execution phase of apoptosis
GO:0002521	0.543	leukocyte differentiation
GO:0006950	0.520	response to stress
GO:0002573	0.517	myeloid leukocyte differentiation
GO:0048513	0.515	animal organ development
GO:0071260	0.507	cellular response to mechanical stimulus
GO:0002376	0.452	immune system process
GO:0070887	0.449	cellular response to chemical stimulus
GO:0009056	0.426	catabolic process
GO:0009057	0.391	macromolecule catabolic process
GO:0010556	0.350	regulation of macromolecule biosynthetic process
GO:0044237	0.349	cellular metabolic process
GO:0031326	0.348	regulation of cellular biosynthetic process
GO:0019219	0.346	regulation of nucleobase-containing compound metabolic process
GO:0050793	0.336	regulation of developmental process
GO:0060548	0.331	negative regulation of cell death
GO:0080134	0.330	regulation of response to stress
GO:0043281	0.326	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051252	0.325	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.995	nucleoplasm
GO:0032991	0.971	protein-containing complex
GO:0016020	0.946	membrane
GO:0071944	0.927	cell periphery
GO:0005886	0.909	plasma membrane
GO:0098796	0.489	membrane protein complex
GO:0005739	0.418	mitochondrion
GO:0098797	0.375	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]