StarFunc result for job id Q14802

User Input

>input (87 residues)
MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAK
CKCKFGQKSGHHPGETPPLITPGSAQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14802	1.000	1.000	1.779E-14	87	1.000	1.000	Q14802.pdb.gz	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
2	AFDB:Q61835	0.580	0.574	2.599E-8	88	0.736	0.727	Q61835.pdb.gz	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
3	AFDB:P59646	0.578	0.567	6.241E-6	89	0.540	0.528	P59646.pdb.gz	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
4	AFDB:Q63113	0.612	0.612	7.183E-6	87	0.517	0.517	Q63113.pdb.gz	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
5	AFDB:Q9H0Q3	0.649	0.601	3.026E-3	95	0.333	0.305	Q9H0Q3.pdb.gz	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
6	AFDB:I3LMB3	0.572	0.572	5.310E-3	87	0.333	0.333	I3LMB3.pdb.gz	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
7	AFDB:C0HJJ0	0.436	0.534	1.169E-1	69	0.264	0.333	C0HJJ0.pdb.gz	FXY11_DANRE FXYD domain-containing ion transport regulator 11 OS=Danio rerio OX=7955 GN=fxyd11 PE=1 SV=1
8	AFDB:P58549	0.478	0.517	2.361E-1	80	0.241	0.263	P58549.pdb.gz	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
9	AFDB:P59649	0.490	0.530	3.127E-1	80	0.218	0.237	P59649.pdb.gz	FXYD7_RAT FXYD domain-containing ion transport regulator 7 OS=Rattus norvegicus OX=10116 GN=Fxyd7 PE=1 SV=1
10	AFDB:Q96DB9	0.435	0.219	3.355E-1	178	0.218	0.107	Q96DB9.pdb.gz	FXYD5_HUMAN FXYD domain-containing ion transport regulator 5 OS=Homo sapiens OX=9606 GN=FXYD5 PE=1 SV=2
11	PDB:5a63D	0.403	0.361	2.044	100	0.172	0.150	5a63D.pdb.gz
12	PDB:6s7oH	0.364	0.304	2.707	108	0.103	0.083	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
13	PDB:6sqwA	0.338	0.273	3.115	114	0.092	0.070	6sqwA.pdb.gz	The First Structure of an Active Mammalian dCTPase and its Complexes With Substrate Analogs and Products.
14	PDB:1kqfC	0.254	0.137	4.127	216	0.115	0.046	1kqfC.pdb.gz	Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
15	PDB:7f3tA	0.279	0.085	5.095	330	0.103	0.027	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
16	PDB:6lo8F	0.370	0.381	6.749	84	0.046	0.048	6lo8F.pdb.gz
17	PDB:3jc5A	0.322	0.153	7.767	208	0.126	0.053	3jc5A.pdb.gz
18	PDB:5svaT	0.246	0.238	7.767	91	0.126	0.121	5svaT.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
19	PDB:7pubCI	0.333	0.076	7.767	427	0.092	0.019	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:4k5yA	0.365	0.097	9.589	407	0.080	0.017	4k5yA.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14802	1.55e-60	180	87	1.000	1.000	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
2	Q61835	2.07e-39	127	88	0.736	0.727	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
3	Q63113	4.05e-27	96.3	87	0.517	0.517	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
4	P59646	8.69e-18	72.8	89	0.471	0.461	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
5	Q9D164	2.66e-15	66.6	94	0.368	0.340	FXYD6_MOUSE FXYD domain-containing ion transport regulator 6 OS=Mus musculus OX=10090 GN=Fxyd6 PE=1 SV=2
6	O00168	4.09e-15	66.2	92	0.310	0.293	PLM_HUMAN Phospholemman OS=Homo sapiens OX=9606 GN=FXYD1 PE=1 SV=2
7	P56513	7.78e-15	65.5	92	0.310	0.293	PLM_CANLF Phospholemman OS=Canis lupus familiaris OX=9615 GN=FXYD1 PE=1 SV=1
8	I3LMB3	1.05e-14	64.7	87	0.345	0.345	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
9	Q9H0Q3	5.95e-14	63.2	95	0.356	0.326	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
10	Q9D2W0	8.63e-14	62.8	88	0.529	0.523	FXYD4_MOUSE FXYD domain-containing ion transport regulator 4 OS=Mus musculus OX=10090 GN=Fxyd4 PE=3 SV=1
11	Q3SZX0	9.32e-14	62.8	92	0.299	0.283	PLM_BOVIN Phospholemman OS=Bos taurus OX=9913 GN=FXYD1 PE=1 SV=1
12	P58549	9.16e-08	47.0	80	0.218	0.237	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
13	P54710	8.86e-07	44.3	66	0.218	0.288	ATNG_HUMAN Sodium/potassium-transporting ATPase subunit gamma OS=Homo sapiens OX=9606 GN=FXYD2 PE=1 SV=3
14	B0S4R3	1.02e-06	43.9	70	0.310	0.386	B0S4R3_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11a PE=2 SV=1
15	B0S4R4	1.08e-06	43.9	70	0.230	0.286	B0S4R4_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11b PE=2 SV=1
16	Q58K79	1.31e-06	43.5	65	0.253	0.338	Q58K79_PIG FXYD domain-containing ion transport regulator OS=Sus scrofa OX=9823 GN=FXYD2 PE=1 SV=1
17	Q96DB9	2.17e-06	45.1	178	0.207	0.101	FXYD5_HUMAN FXYD domain-containing ion transport regulator 5 OS=Homo sapiens OX=9606 GN=FXYD5 PE=1 SV=2
18	Q04646	2.98e-06	42.7	70	0.184	0.229	ATNG_MOUSE Sodium/potassium-transporting ATPase subunit gamma OS=Mus musculus OX=10090 GN=Fxyd2 PE=1 SV=2
19	O08589	6.73e-06	42.4	92	0.241	0.228	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2
20	Q9Z239	1.34e-05	41.6	92	0.241	0.228	PLM_MOUSE Phospholemman OS=Mus musculus OX=10090 GN=Fxyd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02038 ATP1G1_PLM_MAT8	3.5e-23	92.1	ATP1G1/PLM/MAT8 family
2	PF07062 Clc-like	1.9e+02	12.9	Clc-like
3	PF06186 DUF992	1.7e+02	13.5	Protein of unknown function (DUF992)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270310	0.704	FXYD domain containing ion transport regulator 7
2	9606.ENSP00000250111	0.703	Sodium/potassium-transporting ATPase subunit beta-2
3	9606.ENSP00000356790	0.680	Sodium/potassium-transporting ATPase subunit beta-1
4	9606.ENSP00000014914	0.669	Retinoic acid-induced protein 3
5	9606.ENSP00000292079	0.661	Sodium/potassium-transporting ATPase subunit gamma
6	9606.ENSP00000344254	0.653	FXYD domain-containing ion transport regulator 5
7	9606.ENSP00000445306	0.636	Sodium/potassium-transporting ATPase subunit alpha-1
8	9606.ENSP00000354490	0.626	Sodium/potassium-transporting ATPase subunit alpha-2
9	9606.ENSP00000444688	0.622	Sodium/potassium-transporting ATPase subunit alpha-3
10	9606.ENSP00000286371	0.608	Sodium/potassium-transporting ATPase subunit beta-3
11	9606.ENSP00000357060	0.605	Sodium/potassium-transporting ATPase subunit alpha-4
12	9606.ENSP00000411471	0.604	ATP-binding cassette sub-family F member 3
13	9606.ENSP00000357691	0.589	Protein S100-A14
14	9606.ENSP00000300557	0.558	Proline-rich protein 15-like protein
15	9606.ENSP00000391490	0.523	Anterior gradient protein 2 homolog
16	9606.ENSP00000300648	0.522	eIF-2-alpha kinase activator GCN1
17	9606.ENSP00000247470	0.505	Apoptosis-associated speck-like protein containing a CARD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.964	transmembrane transporter activity
GO:0015318	0.914	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.914	monoatomic ion transmembrane transporter activity
GO:1901702	0.793	salt transmembrane transporter activity
GO:0005216	0.788	monoatomic ion channel activity
GO:0015108	0.780	chloride transmembrane transporter activity
GO:0005253	0.772	monoatomic anion channel activity
GO:0005254	0.760	chloride channel activity
GO:0019899	0.484	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006811	0.933	monoatomic ion transport
GO:0006820	0.664	monoatomic anion transport
GO:0065007	0.580	biological regulation
GO:0015698	0.528	inorganic anion transport
GO:0050789	0.523	regulation of biological process
GO:0006821	0.478	chloride transport
GO:0009987	0.407	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0043227	0.993	membrane-bounded organelle
GO:0005576	0.962	extracellular region
GO:1903561	0.892	extracellular vesicle
GO:0005622	0.882	intracellular anatomical structure
GO:0043229	0.859	intracellular organelle
GO:0005615	0.858	extracellular space
GO:0070062	0.820	extracellular exosome
GO:0005737	0.720	cytoplasm
GO:0043231	0.575	intracellular membrane-bounded organelle
GO:0012505	0.388	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.780	chloride(in) = chloride(out)

[back to server]