StarFunc result for job id Q14814

User Input

>input (521 residues)
MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14814	0.999	0.999	1.066E-73	521	1.000	1.000	Q14814.pdb.gz	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1
2	AFDB:F1Q910	0.209	0.206	4.640E-44	529	0.701	0.690	F1Q910.pdb.gz
3	AFDB:Q02078	0.205	0.211	1.763E-37	507	0.541	0.556	Q02078.pdb.gz	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
4	AFDB:Q03414	0.199	0.200	4.029E-37	516	0.534	0.539	Q03414.pdb.gz	MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis OX=8355 GN=mef2a PE=1 SV=2
5	AFDB:Q8CFN5	0.224	0.244	1.299E-36	474	0.522	0.574	Q8CFN5.pdb.gz	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
6	AFDB:Q1LXH5	0.188	0.201	4.064E-35	488	0.526	0.561	Q1LXH5.pdb.gz
7	AFDB:Q1LXH4	0.184	0.183	8.669E-35	524	0.526	0.523	Q1LXH4.pdb.gz
8	AFDB:A0A2R8QU09	0.193	0.212	7.853E-34	467	0.524	0.585	A0A2R8QU09.pdb.gz
9	AFDB:A0A0R4J2G5	0.194	0.232	1.272E-33	433	0.497	0.598	A0A0R4J2G5.pdb.gz	A0A0R4J2G5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
10	AFDB:Q6NSN7	0.205	0.216	6.903E-32	491	0.480	0.509	Q6NSN7.pdb.gz
11	PDB:3zqjF	0.056	0.048	5.235E-1	607	0.023	0.020	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
12	PDB:5ndgn4	0.056	0.188	7.386E-1	118	0.013	0.059	5ndgn4.pdb.gz	Aminoglycoside interactions and impacts on the eukaryotic ribosome.
13	PDB:7ls2Q2	0.055	0.191	7.386E-1	110	0.023	0.109	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
14	PDB:1qb3B	0.053	0.191	7.913E-1	119	0.036	0.160	1qb3B.pdb.gz
15	PDB:2jkfA	0.046	0.104	1.042	170	0.006	0.018	2jkfA.pdb.gz
16	PDB:6lss7	0.052	0.148	1.042	135	0.019	0.074	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:1cksB	0.046	0.168	1.117	78	0.023	0.154	1cksB.pdb.gz
18	PDB:7qooP	0.062	0.120	1.117	233	0.021	0.047	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
19	PDB:4wmqA	0.039	0.064	1.196	283	0.006	0.011	4wmqA.pdb.gz	Recognition of microbial glycans by human intelectin-1.
20	PDB:7pzyt	0.062	0.135	1.373	200	0.031	0.080	7pzyt.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O89038	0.0	969	507	0.942	0.968	MEF2D_RAT Myocyte-specific enhancer factor 2D OS=Rattus norvegicus OX=10116 GN=Mef2d PE=1 SV=1
2	Q14814	0.0	1046	521	1.000	1.000	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1
3	Q63943	0.0	994	514	0.960	0.973	MEF2D_MOUSE Myocyte-specific enhancer factor 2D OS=Mus musculus OX=10090 GN=Mef2d PE=1 SV=2
4	Q98870	0.0	583	529	0.693	0.682	Q98870_DANRE Myocyte enhancer factor 2D MEF2D OS=Danio rerio OX=7955 GN=mef2D PE=2 SV=1
5	A0A0S2Z4N0	2.39e-158	462	505	0.551	0.568	A0A0S2Z4N0_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
6	A0A0S2Z417	1.76e-156	457	497	0.549	0.575	A0A0S2Z417_HUMAN Myocyte enhancer factor 2A isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
7	Q60929	2.08e-154	451	498	0.545	0.570	MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus OX=10090 GN=Mef2a PE=1 SV=2
8	Q02078	2.63e-153	449	507	0.543	0.558	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
9	A0A0S2Z454	9.56e-152	445	499	0.541	0.565	A0A0S2Z454_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_b (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
10	Q03414	2.32e-151	444	516	0.534	0.539	MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis OX=8355 GN=mef2a PE=1 SV=2
11	Q2MJT0	2.73e-145	428	495	0.530	0.558	MEF2A_RAT Myocyte-specific enhancer factor 2A OS=Rattus norvegicus OX=10116 GN=Mef2a PE=1 SV=1
12	Q1LXH6	5.68e-135	400	458	0.509	0.579	Q1LXH6_DANRE Myocyte enhancer factor 2aa OS=Danio rerio OX=7955 GN=etID309779.18 PE=4 SV=1
13	Q9PSD8	7.02e-134	395	382	0.445	0.607	Q9PSD8_XENLA DNA binding protein MEF2 OS=Xenopus laevis OX=8355 PE=4 SV=1
14	A0A096MJY4	7.26e-134	398	473	0.520	0.573	MEF2C_RAT Myocyte-specific enhancer factor 2C OS=Rattus norvegicus OX=10116 GN=Mef2c PE=1 SV=1
15	A0A0R4IRM3	1.38e-133	397	460	0.507	0.574	A0A0R4IRM3_DANRE Myocyte enhancer factor 2aa OS=Danio rerio OX=7955 GN=etID309779.18 PE=4 SV=1
16	Q8CFN5	1.67e-133	397	474	0.518	0.570	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
17	Q06413	6.85e-133	395	473	0.516	0.569	MEF2C_HUMAN Myocyte-specific enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
18	A0A0D9SGI5	4.10e-132	394	471	0.499	0.552	A0A0D9SGI5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
19	A0A1B0GV32	5.50e-132	393	462	0.509	0.574	A0A1B0GV32_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
20	A2BGA7	5.89e-125	375	474	0.491	0.540	A2BGA7_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10152 CCDC53	28	16.6	Subunit CCDC53 of WASH complex
2	PF12347 HJURP_C	1.5e-10	52.2	Holliday junction regulator protein family C-terminal repeat
3	PF00319 SRF-TF	2e-21	86.5	SRF-type transcription factor (DNA-binding and dimerisation domain)
4	PF03153 TFIIA	1.6e+02	13.7	Transcription factor IIA, alpha/beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264606	0.996	Histone deacetylase 4
2	9606.ENSP00000225983	0.995	Histone deacetylase 5
3	9606.ENSP00000250003	0.991	Myoblast determination protein 1
4	9606.ENSP00000381364	0.990	Calcineurin-binding protein cabin-1
5	9606.ENSP00000408617	0.987	Histone deacetylase 9
6	9606.ENSP00000263253	0.986	Histone acetyltransferase p300
7	9606.ENSP00000311005	0.986	Mitogen-activated protein kinase 7
8	9606.ENSP00000340896	0.974	Set1/Ash2 histone methyltransferase complex subunit ASH2
9	9606.ENSP00000346389	0.973	Myocyte-specific enhancer factor 2A
10	9606.ENSP00000229795	0.971	Mitogen-activated protein kinase 14
11	9606.ENSP00000362649	0.965	Histone deacetylase 1
12	9606.ENSP00000379330	0.965	Nuclear factor of activated T-cells, cytoplasmic 2
13	9606.ENSP00000215659	0.951	Mitogen-activated protein kinase 12
14	9606.ENSP00000333685	0.950	Mitogen-activated protein kinase 11
15	9606.ENSP00000378323	0.949	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
16	9606.ENSP00000371267	0.948	14-3-3 protein theta
17	9606.ENSP00000440864	0.948	Nuclear receptor subfamily 4 group A member 1
18	9606.ENSP00000430432	0.945	Histone deacetylase 2
19	9606.ENSP00000211287	0.943	Mitogen-activated protein kinase 13
20	9606.ENSP00000328551	0.942	Ras-related protein Rab-28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042826	1.000	histone deacetylase binding
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0061629	0.987	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042802	0.651	identical protein binding
GO:0001216	0.441	DNA-binding transcription activator activity
GO:0001228	0.412	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.990	positive regulation of cellular process
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0045893	0.982	positive regulation of DNA-templated transcription
GO:0048856	0.936	anatomical structure development
GO:0032501	0.935	multicellular organismal process
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0045944	0.928	positive regulation of transcription by RNA polymerase II
GO:0009987	0.904	cellular process
GO:0007275	0.748	multicellular organism development
GO:0048731	0.685	system development
GO:0048513	0.475	animal organ development
GO:0061061	0.399	muscle structure development
GO:0072359	0.353	circulatory system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0005829	0.505	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]