StarFunc result for job id Q14839

User Input

>input (1912 residues)
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
GPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
FSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDER
SEAPRRPSRKGLRNDKDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFT
TQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMS
LIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPA
EDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEK
AEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAG
IINHGYARWQDIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLR
RAAYLNMSEDPSHPSMALNTRFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEEL
LSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLANRAPEPTPQQVAQQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q3B4	0.554	0.579	0.000	1820	0.658	0.692	A0A2R8Q3B4.pdb.gz
2	AFDB:E9PU01	0.673	0.670	0.000	1921	0.981	0.977	E9PU01.pdb.gz	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
3	AFDB:F1QWV5	0.650	0.638	0.000	1952	0.783	0.767	F1QWV5.pdb.gz
4	AFDB:O97159	0.622	0.604	0.000	1982	0.566	0.546	O97159.pdb.gz	CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster OX=7227 GN=Mi-2 PE=1 SV=2
5	AFDB:Q54Q16	0.315	0.315	9.064E-67	1917	0.238	0.238	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
6	AFDB:Q09XV5	0.325	0.247	2.420E-60	2582	0.213	0.158	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
7	AFDB:B0R0I6	0.353	0.276	5.915E-60	2511	0.222	0.169	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
8	AFDB:A0A1D8PJG4	0.250	0.361	1.218E-47	1302	0.143	0.210	A0A1D8PJG4.pdb.gz	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
9	AFDB:Q3TKT4	0.248	0.291	7.280E-47	1613	0.187	0.221	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
10	AFDB:Q7ZSY3	0.249	0.291	2.240E-45	1627	0.186	0.218	Q7ZSY3.pdb.gz	Q7ZSY3_DANRE Brahma protein-like protein 1 OS=Danio rerio OX=7955 GN=smarca4 PE=1 SV=1
11	PDB:6g0lW	0.281	0.593	1.386E-42	878	0.146	0.318	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6g0lM	0.279	0.599	3.067E-42	855	0.141	0.315	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:6jylK	0.229	0.849	1.264E-37	504	0.116	0.440	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
14	PDB:6tdaS	0.229	0.551	2.441E-35	783	0.111	0.272	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
15	PDB:6uxwA	0.237	0.563	1.363E-33	778	0.115	0.283	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
16	PDB:7epuB	0.172	0.358	5.473E-33	748	0.114	0.291	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
17	PDB:6kw3Y	0.230	0.765	1.077E-31	548	0.115	0.401	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:6gejM	0.218	0.587	3.055E-31	688	0.106	0.294	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7oo3b	0.214	0.718	4.325E-31	534	0.086	0.309	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
20	PDB:5vvrM	0.202	0.691	1.772E-23	503	0.079	0.300	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGG9	3933	1937	0.998	0.986	A0A0C4DGG9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
2	A0A2R8Y212	3957	1914	1.000	0.999	A0A2R8Y212_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
3	A0A2R8Y425	3899	1889	0.986	0.998	A0A2R8Y425_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
4	A0A2R8Y521	3885	1920	0.990	0.985	A0A2R8Y521_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
5	A0A2R8Y5J0	3905	1892	0.990	1.000	A0A2R8Y5J0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
6	A0A2R8Y8C1	3377	1669	0.858	0.983	A0A2R8Y8C1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
7	A0A2R8YFD8	3929	1903	0.995	1.000	A0A2R8YFD8_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
8	A0A2R8YFK9	3925	1899	0.993	1.000	A0A2R8YFK9_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
9	A0A2U3TZM0	3913	1902	0.993	0.998	A0A2U3TZM0_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
10	A0A8I6ACF8	3773	1899	0.961	0.968	A0A8I6ACF8_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=1
11	A2A8L1	2590	1946	0.701	0.689	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1
12	B1AR17	2495	2055	0.692	0.644	B1AR17_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
13	D3ZD32	2593	1948	0.704	0.691	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
14	E9PU01	3895	1928	0.984	0.976	E9PU01_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Chd4 PE=1 SV=4
15	E9Q614	2491	2021	0.687	0.650	E9Q614_MOUSE DNA helicase OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
16	F5GWX5	3941	1905	0.996	1.000	F5GWX5_HUMAN DNA helicase OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
17	F5H6N4	700	354	0.185	1.000	F5H6N4_HUMAN Chromodomain helicase DNA binding protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=1
18	F7C528	2495	1886	0.687	0.697	F7C528_MOUSE DNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Chd3 PE=1 SV=1
19	G5EBZ4	1431	1829	0.389	0.406	LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans OX=6239 GN=let-418 PE=1 SV=1
20	O16102	1016	892	0.262	0.561	CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster OX=7227 GN=Chd3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08074 CHDCT2	2.2e-73	256.6	CHDCT2 (NUC038) domain
2	PF06461 CHDII_SANT-like	3.9e-58	206.7	CHD subfamily II, SANT-like domain
3	PF08073 CHDNT	4.8e-21	85.7	CHDNT (NUC034) domain
4	PF00385 Chromo	5e-15	66.5	Chromo (CHRromatin Organisation MOdifier) domain
5	PF00270 DEAD	1.6e+02	13.5	DEAD/DEAH box helicase
6	PF06465 DUF1087	3e-22	89.8	CHD subfamily II, DUF1087
7	PF11496 HDA2-3	0.044	24.5	Class II histone deacetylase complex subunits 2 and 3
8	PF00271 Helicase_C	7.1e-19	79.6	Helicase conserved C-terminal domain
9	PF00505 HMG_box	18	17.1	HMG (high mobility group) box
10	PF00628 PHD	3.8e-18	76.4	PHD-finger
11	PF13831 PHD_2	6.5	17.6	PHD-finger
12	PF04851 ResIII	8.9e-07	40.6	Type III restriction enzyme, res subunit
13	PF00176 SNF2-rel_dom	4.9e-58	208.1	SNF2-related domain
14	PF13771 zf-HC5HC2H	2.8	19.6	PHD-like zinc-binding domain
15	PF13832 zf-HC5HC2H_2	3.8e+02	12.7	PHD-zinc-finger like domain
16	PF15446 zf-PHD-like	4e+02	12.0	PHD/FYVE-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278823	0.999	Metastasis-associated protein MTA2
2	9606.ENSP00000353463	0.999	Transcriptional repressor p66-alpha
3	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
4	9606.ENSP00000362649	0.999	Histone deacetylase 1
5	9606.ENSP00000369424	0.999	Histone-binding protein RBBP7
6	9606.ENSP00000430432	0.999	Histone deacetylase 2
7	9606.ENSP00000333633	0.998	Metastasis-associated protein MTA1
8	9606.ENSP00000357644	0.998	Transcriptional repressor p66-beta
9	9606.ENSP00000412302	0.997	Methyl-CpG-binding domain protein 3
10	9606.ENSP00000331614	0.995	DNA-binding protein Ikaros
11	9606.ENSP00000320147	0.992	Histone-lysine N-methyltransferase EZH2
12	9606.ENSP00000476960	0.991	Histone cluster 2 H3 pseudogene 2
13	9606.ENSP00000383973	0.990	Metastasis-associated protein MTA3
14	9606.ENSP00000300131	0.989	NGFI-A-binding protein 2
15	9606.ENSP00000369716	0.988	Chromodomain-helicase-DNA-binding protein 3
16	9606.ENSP00000263253	0.986	Histone acetyltransferase p300
17	9606.ENSP00000302640	0.984	Nucleolar transcription factor 1
18	9606.ENSP00000328484	0.982	Histone H2A type 1-J
19	9606.ENSP00000256429	0.978	Methyl-CpG-binding domain protein 2
20	9606.ENSP00000296417	0.971	Histone H2A.Z

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.987	catalytic activity
GO:0003682	0.984	chromatin binding
GO:0140640	0.966	catalytic activity, acting on a nucleic acid
GO:0008094	0.962	ATP-dependent activity, acting on DNA
GO:1901363	0.943	heterocyclic compound binding
GO:0097159	0.940	organic cyclic compound binding
GO:0140658	0.936	ATP-dependent chromatin remodeler activity
GO:0003676	0.933	nucleic acid binding
GO:0016462	0.925	pyrophosphatase activity
GO:0017111	0.923	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.911	ATP hydrolysis activity
GO:0003677	0.895	DNA binding
GO:0043565	0.654	sequence-specific DNA binding
GO:0008134	0.634	transcription factor binding
GO:0003690	0.555	double-stranded DNA binding
GO:1990837	0.554	sequence-specific double-stranded DNA binding
GO:0000976	0.486	transcription cis-regulatory region binding
GO:0140297	0.400	DNA-binding transcription factor binding
GO:0031491	0.398	nucleosome binding
GO:0042393	0.383	histone binding
GO:0042826	0.333	histone deacetylase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.978	biological regulation
GO:0050789	0.967	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0071840	0.949	cellular component organization or biogenesis
GO:0051252	0.913	regulation of RNA metabolic process
GO:0009889	0.907	regulation of biosynthetic process
GO:0016043	0.904	cellular component organization
GO:0071704	0.841	organic substance metabolic process
GO:0009892	0.810	negative regulation of metabolic process
GO:0010468	0.778	regulation of gene expression
GO:0043170	0.764	macromolecule metabolic process
GO:0044238	0.741	primary metabolic process
GO:0031326	0.734	regulation of cellular biosynthetic process
GO:0010556	0.733	regulation of macromolecule biosynthetic process
GO:0006807	0.712	nitrogen compound metabolic process
GO:0006355	0.645	regulation of DNA-templated transcription
GO:0010605	0.609	negative regulation of macromolecule metabolic process
GO:0006357	0.576	regulation of transcription by RNA polymerase II
GO:0044237	0.541	cellular metabolic process
GO:0048523	0.520	negative regulation of cellular process
GO:0051172	0.514	negative regulation of nitrogen compound metabolic process
GO:0031324	0.491	negative regulation of cellular metabolic process
GO:1901564	0.484	organonitrogen compound metabolic process
GO:0045934	0.478	negative regulation of nucleobase-containing compound metabolic process
GO:0006325	0.415	chromatin organization
GO:0019538	0.402	protein metabolic process
GO:0031327	0.382	negative regulation of cellular biosynthetic process
GO:0010558	0.379	negative regulation of macromolecule biosynthetic process
GO:0051253	0.379	negative regulation of RNA metabolic process
GO:0045892	0.373	negative regulation of DNA-templated transcription
GO:0034641	0.333	cellular nitrogen compound metabolic process
GO:0006139	0.320	nucleobase-containing compound metabolic process
GO:0050896	0.318	response to stimulus
GO:0090304	0.304	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0032991	0.783	protein-containing complex
GO:0005737	0.598	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.925	In phosphorus-containing anhydrides.
RHEA:23680	0.923	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.923	nucleoside-triphosphate phosphatase.
RHEA:13065	0.911	ATP + H2O = ADP + H(+) + phosphate

[back to server]