StarFunc result for job id Q14849

User Input

>input (445 residues)
MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFD
LLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRH
WWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEE
ERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIR
QGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEV
ILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRY
LSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIH
QSLAATMFEFAFHLRQRISELGARA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61542	0.910	0.908	6.501E-74	446	0.937	0.935	Q61542.pdb.gz	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
2	AFDB:J3QLM1	0.559	0.529	2.097E-56	475	0.863	0.808	J3QLM1.pdb.gz	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
3	AFDB:P49675	0.462	0.716	7.386E-23	285	0.175	0.274	P49675.pdb.gz	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
4	AFDB:P51557	0.462	0.718	1.568E-22	284	0.204	0.320	P51557.pdb.gz	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
5	AFDB:Q9DG10	0.475	0.732	2.988E-22	285	0.180	0.281	Q9DG10.pdb.gz	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
6	AFDB:A0A024RA89	0.336	0.622	4.801E-17	234	0.292	0.556	A0A024RA89.pdb.gz
7	PDB:2r55A	0.432	0.901	7.670E-16	208	0.115	0.245	2r55A.pdb.gz
8	AFDB:Q9NSY2	0.436	0.889	1.419E-15	213	0.112	0.235	Q9NSY2.pdb.gz	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
9	PDB:5brlA	0.422	0.864	4.520E-15	210	0.101	0.214	5brlA.pdb.gz
10	PDB:6l1dA	0.397	0.845	5.311E-15	200	0.106	0.235	6l1dA.pdb.gz
11	AFDB:Q96DR4	0.399	0.833	2.729E-14	205	0.106	0.229	Q96DR4.pdb.gz	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
12	AFDB:Q99JV5	0.431	0.833	2.729E-14	224	0.097	0.192	Q99JV5.pdb.gz	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
13	AFDB:Q9EQG9	0.359	0.268	2.632E-12	624	0.171	0.122	Q9EQG9.pdb.gz	CERT_MOUSE Ceramide transfer protein OS=Mus musculus OX=10090 GN=Cert1 PE=1 SV=1
14	PDB:6serA	0.345	0.598	5.502E-11	245	0.076	0.139	6serA.pdb.gz
15	PDB:1ln1A	0.325	0.650	7.067E-7	203	0.065	0.143	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
16	PDB:4n0gC	0.230	0.573	1.371E-4	145	0.045	0.138	4n0gC.pdb.gz	Molecular basis for the selective and ABA-independent inhibition of PP2CA by PYL13
17	PDB:3w9rA	0.239	0.521	3.807E-4	171	0.045	0.117	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
18	PDB:4oicA	0.217	0.435	4.473E-4	182	0.038	0.093	4oicA.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
19	PDB:4c9iF	0.214	0.470	5.256E-4	162	0.040	0.111	4c9iF.pdb.gz	The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
20	PDB:3ojiB	0.233	0.476	6.176E-4	185	0.047	0.114	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QLM1	0.0	770	475	0.865	0.811	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
2	Q14849	0.0	909	445	1.000	1.000	STAR3_HUMAN StAR-related lipid transfer protein 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=2
3	Q61542	0.0	813	446	0.937	0.935	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
4	O95772	2.16e-80	250	234	0.288	0.547	STR3N_HUMAN STARD3 N-terminal-like protein OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1
5	C9JPX5	2.93e-75	236	206	0.274	0.592	C9JPX5_HUMAN STARD3 N-terminal like (Fragment) OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1
6	C9J3F5	2.87e-72	227	184	0.254	0.614	C9J3F5_HUMAN STARD3 N-terminal like (Fragment) OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1
7	C9JKL2	8.49e-68	217	216	0.256	0.528	C9JKL2_HUMAN STARD3 N-terminal like OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1
8	C9JJ39	8.85e-64	205	172	0.229	0.593	C9JJ39_HUMAN STARD3 N-terminal like (Fragment) OS=Homo sapiens OX=9606 GN=STARD3NL PE=1 SV=1
9	P97826	3.30e-44	157	284	0.180	0.282	STAR_RAT Steroidogenic acute regulatory protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Star PE=1 SV=1
10	P51557	1.65e-43	156	284	0.180	0.282	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
11	P49675	7.02e-43	154	285	0.175	0.274	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
12	Q9DG10	3.58e-41	150	285	0.169	0.263	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
13	Q9NSY2	1.84e-13	71.6	213	0.090	0.188	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
14	Q96DR4	3.04e-13	70.5	205	0.083	0.180	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
15	Q99JV5	2.69e-11	65.5	224	0.076	0.152	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
16	H0YFF3	0.006	39.7	169	0.065	0.172	H0YFF3_HUMAN StAR related lipid transfer domain containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
17	F5H1Z6	0.007	40.4	252	0.076	0.135	F5H1Z6_HUMAN StAR related lipid transfer domain containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
18	Q9JMD3	0.010	40.0	291	0.076	0.117	STA10_MOUSE START domain-containing protein 10 OS=Mus musculus OX=10090 GN=Stard10 PE=1 SV=1
19	Q9Y365	0.010	40.0	291	0.076	0.117	STA10_HUMAN START domain-containing protein 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=2
20	Q8WXI4	0.012	40.4	607	0.070	0.051	ACO11_HUMAN Acyl-coenzyme A thioesterase 11 OS=Homo sapiens OX=9606 GN=ACOT11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10457 MENTAL	2.6e-61	218.0	Cholesterol-capturing domain
2	PF01852 START	2.3e-47	172.7	START domain
3	PF03699 UPF0182	2.4e+02	11.3	Uncharacterised protein family (UPF0182)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369860	0.930	Motile sperm domain-containing protein 2
2	9606.ENSP00000276449	0.913	Steroidogenic acute regulatory protein, mitochondrial
3	9606.ENSP00000345656	0.885	Vesicle-associated membrane protein-associated protein A
4	9606.ENSP00000417175	0.832	Vesicle-associated membrane protein-associated protein B/C
5	9606.ENSP00000451112	0.832	Epididymal secretory protein E1
6	9606.ENSP00000300658	0.828	Post-GPI attachment to proteins factor 3
7	9606.ENSP00000009041	0.809	STARD3 N-terminal-like protein
8	9606.ENSP00000268896	0.797	Phosphatidylcholine transfer protein
9	9606.ENSP00000377778	0.790	Migration and invasion enhancer 1
10	9606.ENSP00000403459	0.751	Growth factor receptor-bound protein 7
11	9606.ENSP00000269228	0.713	Niemann-Pick C1 protein
12	9606.ENSP00000324944	0.713	Lysophospholipid acyltransferase 1
13	9606.ENSP00000369862	0.709	Collagen type IV alpha-3-binding protein
14	9606.ENSP00000355964	0.691	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
15	9606.ENSP00000312624	0.664	Telethonin
16	9606.ENSP00000263847	0.647	Oxysterol-binding protein 1
17	9606.ENSP00000296632	0.620	StAR-related lipid transfer protein 4
18	9606.ENSP00000462349	0.612	StAR-related lipid transfer protein 6
19	9606.ENSP00000377282	0.610	Protrudin
20	9606.ENSP00000263650	0.609	Oxysterol-binding protein-related protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	1.000	protein dimerization activity
GO:0015485	1.000	cholesterol binding
GO:0042802	0.999	identical protein binding
GO:0042803	0.916	protein homodimerization activity
GO:0005215	0.885	transporter activity
GO:0120013	0.392	lipid transfer activity
GO:0015248	0.326	sterol transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044281	0.988	small molecule metabolic process
GO:0006629	0.987	lipid metabolic process
GO:0051234	0.979	establishment of localization
GO:0008202	0.976	steroid metabolic process
GO:0006810	0.969	transport
GO:0065007	0.919	biological regulation
GO:0044237	0.871	cellular metabolic process
GO:1901615	0.756	organic hydroxy compound metabolic process
GO:0015850	0.714	organic hydroxy compound transport
GO:0033036	0.694	macromolecule localization
GO:0008610	0.628	lipid biosynthetic process
GO:0010876	0.623	lipid localization
GO:0006869	0.568	lipid transport
GO:1901362	0.558	organic cyclic compound biosynthetic process
GO:0015918	0.513	sterol transport
GO:0016043	0.504	cellular component organization
GO:0030301	0.503	cholesterol transport
GO:0051649	0.460	establishment of localization in cell
GO:0006694	0.362	steroid biosynthetic process
GO:0016125	0.360	sterol metabolic process
GO:1902652	0.356	secondary alcohol metabolic process
GO:0051640	0.328	organelle localization
GO:0065008	0.324	regulation of biological quality
GO:0008203	0.320	cholesterol metabolic process
GO:0051656	0.312	establishment of organelle localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0016020	0.996	membrane
GO:0031090	0.975	organelle membrane
GO:0031982	0.973	vesicle
GO:0005634	0.969	nucleus
GO:0005654	0.962	nucleoplasm
GO:0031410	0.960	cytoplasmic vesicle
GO:0005829	0.952	cytosol
GO:0031984	0.944	organelle subcompartment
GO:0005783	0.926	endoplasmic reticulum
GO:0042175	0.902	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.893	endoplasmic reticulum membrane
GO:0005768	0.855	endosome
GO:0098588	0.846	bounding membrane of organelle
GO:0005770	0.797	late endosome
GO:0005739	0.389	mitochondrion
GO:0071944	0.353	cell periphery
GO:0030659	0.352	cytoplasmic vesicle membrane
GO:0005886	0.342	plasma membrane
GO:0010008	0.308	endosome membrane
GO:0005773	0.303	vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.326	cholesterol(in) = cholesterol(out)

[back to server]