StarFunc result for job id Q14863

User Input

>input (301 residues)
MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLA
SSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCS
ETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAY
SQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTS
FTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQI
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31367	0.507	0.260	4.679E-30	610	0.714	0.352	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
2	AFDB:A0A0R4J6S2	0.520	0.240	2.625E-23	694	0.595	0.258	A0A0R4J6S2.pdb.gz	A0A0R4J6S2_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pou6f2 PE=3 SV=1
3	AFDB:A0A2R8Y739	0.474	0.402	4.433E-14	361	0.316	0.263	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
4	AFDB:P20267	0.472	0.325	1.226E-13	451	0.299	0.200	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
5	AFDB:O73861	0.469	0.383	1.297E-13	372	0.296	0.239	O73861.pdb.gz	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
6	AFDB:P16241	0.466	0.333	1.297E-13	427	0.316	0.222	P16241.pdb.gz	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
7	AFDB:Q7T103	0.452	0.309	1.626E-13	449	0.322	0.216	Q7T103.pdb.gz	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1
8	AFDB:P10037	0.446	0.459	1.721E-13	291	0.319	0.330	P10037.pdb.gz	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
9	AFDB:P20264	0.485	0.299	2.282E-13	500	0.336	0.202	P20264.pdb.gz	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
10	AFDB:P20268	0.474	0.379	3.204E-13	380	0.342	0.271	P20268.pdb.gz	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
11	PDB:6t90K	0.216	0.866	1.671E-4	73	0.096	0.397	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:5iplF	0.125	0.131	4.247E-2	277	0.086	0.094	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
13	PDB:4egcA	0.155	0.093	1.472E-1	539	0.096	0.054	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
14	PDB:2hi3A	0.174	0.626	4.071E-1	73	0.050	0.205	2hi3A.pdb.gz
15	PDB:2w96A	0.117	0.137	5.104E-1	249	0.063	0.076	2w96A.pdb.gz
16	PDB:1g3nC	0.123	0.144	5.401E-1	233	0.086	0.112	1g3nC.pdb.gz
17	PDB:6dv9F	0.089	0.139	6.771E-1	174	0.066	0.115	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:3g46A	0.111	0.193	8.981E-1	146	0.066	0.137	3g46A.pdb.gz	Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
19	PDB:3dnvB	0.155	0.570	9.503E-1	71	0.047	0.197	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
20	PDB:7fbyA	0.135	0.242	9.503E-1	153	0.033	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1C7CYV8	0.0	606	611	1.000	0.493	A0A1C7CYV8_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
2	A0A1C7CYY7	0.0	604	577	1.000	0.522	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
3	P56223	0.0	577	301	0.963	0.963	PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou6f1 PE=2 SV=1
4	Q07916	0.0	575	301	0.953	0.953	PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
5	Q14863	0.0	600	301	1.000	1.000	PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
6	Q5U4D4	0.0	577	576	0.953	0.498	Q5U4D4_MOUSE POU domain protein OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
7	P31367	5.75e-138	405	610	0.738	0.364	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
8	P78424	2.18e-102	316	691	0.605	0.263	PO6F2_HUMAN POU domain, class 6, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU6F2 PE=1 SV=3
9	A0A0R4J6S2	4.41e-101	312	694	0.588	0.255	A0A0R4J6S2_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pou6f2 PE=3 SV=1
10	A0A0B4LEG2	1.14e-76	256	1273	0.385	0.091	A0A0B4LEG2_DROME POU domain protein OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=3 SV=1
11	Q7JUR9	2.59e-72	242	994	0.382	0.116	Q7JUR9_DROME AT16994p OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=2 SV=1
12	B7YZU0	8.03e-72	242	1291	0.382	0.089	B7YZU0_DROME Pou domain motif 3, isoform C OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=2
13	A0A0B4JD55	1.12e-71	242	1292	0.382	0.089	A0A0B4JD55_DROME Pou domain motif 3, isoform F OS=Drosophila melanogaster OX=7227 GN=pdm3 PE=4 SV=1
14	Q00286	1.32e-42	150	291	0.262	0.271	PIT1_MOUSE Pituitary-specific positive transcription factor 1 OS=Mus musculus OX=10090 GN=Pou1f1 PE=1 SV=1
15	P10037	2.36e-42	149	291	0.262	0.271	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
16	P28069	8.38e-42	147	291	0.262	0.271	PIT1_HUMAN Pituitary-specific positive transcription factor 1 OS=Homo sapiens OX=9606 GN=POU1F1 PE=1 SV=1
17	Q91989	2.92e-40	147	426	0.252	0.178	P5F13_XENLA POU domain, class 5, transcription factor 1.3 OS=Xenopus laevis OX=8355 GN=pou5f1.3 PE=1 SV=1
18	Q6TGI4	2.16e-39	143	350	0.243	0.209	Q6TGI4_DANRE POU domain protein OS=Danio rerio OX=7955 GN=pit1 PE=2 SV=1
19	A7Y7W2	6.36e-39	142	389	0.246	0.190	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
20	Q08478	8.94e-38	139	358	0.233	0.196	PIT1_ONCMY Pituitary-specific positive transcription factor 1 OS=Oncorhynchus mykiss OX=8022 GN=pou1f1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.6	18.9	Homeobox KN domain
2	PF00046 Homeodomain	1.6e-15	68.0	Homeodomain
3	PF13560 HTH_31	4e+02	12.7	Helix-turn-helix domain
4	PF00157 Pou	1.8e-28	109.6	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008959498.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003820015.1	0.695	Brain-specific homeobox protein homolog
2	9597.XP_003828052.1	0.576	SMAD family member 3
3	9597.XP_008958403.1	0.560	Belongs to the histone H2B family.
4	9597.XP_003829211.1	0.535	histidyl-tRNA synthetase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	0.999	sequence-specific DNA binding
GO:0005515	0.993	protein binding
GO:0003700	0.976	DNA-binding transcription factor activity
GO:0000981	0.965	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.947	sequence-specific double-stranded DNA binding
GO:0000976	0.838	transcription cis-regulatory region binding
GO:0000978	0.668	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.979	biological regulation
GO:0051252	0.955	regulation of RNA metabolic process
GO:0032501	0.948	multicellular organismal process
GO:1903506	0.947	regulation of nucleic acid-templated transcription
GO:0006355	0.944	regulation of DNA-templated transcription
GO:0048513	0.926	animal organ development
GO:0007275	0.856	multicellular organism development
GO:0007399	0.780	nervous system development
GO:0045892	0.758	negative regulation of DNA-templated transcription
GO:0060322	0.736	head development
GO:0072359	0.669	circulatory system development
GO:0061061	0.639	muscle structure development
GO:0006357	0.637	regulation of transcription by RNA polymerase II
GO:0000122	0.605	negative regulation of transcription by RNA polymerase II
GO:0007417	0.593	central nervous system development
GO:0007420	0.400	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.974	nuclear lumen
GO:0005654	0.910	nucleoplasm
GO:0043232	0.327	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]