StarFunc result for job id Q14865

User Input

>input (1188 residues)
MEPNSLQWVGSPCGLHGPYIFYKAFQFHLEGKPRILSLGDFFFVRCTPKDPICIAELQLL
WEERTSRQLLSSSKLYFLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKW
RCGFHAGPVKTEALGRNGQKEALLKYRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLS
YPQYCRYRSMLKRIQDKPSSILTDQFALALGGIAVVSRNPQILYCRDTFDHPTLIENESI
CDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAVAKVKCEARSALTKPKNNHNC
KKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQ
KLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPI
KPRKQENSSQENENKTKVSGTKRIKHEIPKSKKEKENAPKPQDAAEVSSEQEKEQETLIS
QKSIPEPLPAADMKKKIEGYQEFSAKPLASRVDPEKDNETDQGSNSEKVAEEAGEKGPTP
PLPSAPLAPEKDSALVPGASKQPLTSPSALVDSKQESKLCCFTESPESEPQEASFPSFPT
TQPPLANQNETEDDKLPAMADYIANCTVKVDQLGSDDIHNALKQTPKVLVVQSFDMFKDK
DLTGPMNENHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVSGASLSSSYPYGSPPPLISKK
KLIARDDLCSSLSQTHHGQSTDHMAVSRPSVIQHVQSFRSKPSEERKTINDIFKHEKLSR
SDPHRCSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMPSFLADFYSSPHLHSL
YRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAP
TDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPM
TMSGPKKYPESLSRSGKPHHVRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLD
LVIAGKKARAVSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG
LYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQL
YRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14865	1.000	1.000	0.000	1188	1.000	1.000	Q14865.pdb.gz	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
2	AFDB:Q8BM75	0.426	0.426	0.000	1188	0.879	0.879	Q8BM75.pdb.gz	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
3	AFDB:F4JCS8	0.079	0.061	2.785E-7	1613	0.155	0.114	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
4	AFDB:A2CG63	0.083	0.075	2.864E-6	1314	0.124	0.112	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
5	AFDB:Q9VWP5	0.085	0.044	9.735E-6	2486	0.156	0.074	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
6	AFDB:F8VPQ2	0.094	0.089	7.481E-5	1261	0.142	0.134	F8VPQ2.pdb.gz	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
7	PDB:5z8lA	0.065	0.332	1.470E-4	204	0.011	0.064	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
8	AFDB:Q70EL1	0.046	0.038	4.827E-4	1684	0.134	0.094	Q70EL1.pdb.gz	UBP54_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54 PE=1 SV=4
9	AFDB:P0DPF3	0.043	0.045	6.267E-3	1111	0.126	0.135	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
10	AFDB:Q38EI4	0.040	0.028	7.464E-3	1857	0.114	0.073	Q38EI4.pdb.gz	Q38EI4_TRYB2 Polymerase nucleotidyl transferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5640 PE=4 SV=1
11	AFDB:Q9VUB7	0.037	0.025	1.261E-2	2294	0.111	0.058	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
12	PDB:7aoaD	0.053	0.169	5.601E-2	343	0.006	0.020	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
13	PDB:5hz9A	0.029	0.151	1.508E-1	135	0.010	0.089	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
14	PDB:6acaA	0.040	0.042	2.548E-1	1133	0.031	0.033	6acaA.pdb.gz
15	PDB:7cgaA	0.030	0.076	4.304E-1	347	0.006	0.020	7cgaA.pdb.gz
16	PDB:6dtlB	0.043	0.102	4.836E-1	357	0.011	0.036	6dtlB.pdb.gz
17	PDB:7d5sA5	0.033	0.057	7.272E-1	514	0.015	0.035	7d5sA5.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:7q3eA	0.036	0.061	8.171E-1	551	0.012	0.025	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
19	PDB:3coiA	0.031	0.080	9.731E-1	344	0.005	0.017	3coiA.pdb.gz
20	PDB:5kcvA	0.040	0.094	9.731E-1	353	0.018	0.059	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14865	0.0	2452	1188	1.000	1.000	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
2	Q8BM75	0.0	2150	1188	0.880	0.880	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
3	A0A669KBH0	1.07e-50	184	327	0.077	0.278	A0A669KBH0_HUMAN AT-rich interaction domain 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=1
4	Q3U108	1.14e-48	186	590	0.077	0.156	ARI5A_MOUSE AT-rich interactive domain-containing protein 5A OS=Mus musculus OX=10090 GN=Arid5a PE=1 SV=1
5	Q03989	1.49e-48	185	594	0.077	0.153	ARI5A_HUMAN AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=2
6	Q9VWP5	4.56e-14	80.1	2486	0.026	0.012	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
7	A2CG63	2.78e-12	73.9	1314	0.043	0.039	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
8	Q4LE39	5.85e-12	72.8	1312	0.024	0.022	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
9	P29374	9.14e-10	65.9	1257	0.024	0.023	ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A PE=1 SV=3
10	F8VPQ2	2.64e-09	64.3	1261	0.024	0.023	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1
11	Q68CP9	4.28e-09	63.5	1835	0.026	0.017	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
12	E9Q7E2	4.61e-09	63.5	1828	0.026	0.017	ARID2_MOUSE AT-rich interactive domain-containing protein 2 OS=Mus musculus OX=10090 GN=Arid2 PE=1 SV=1
13	Q8IN94	1.06e-08	62.4	2716	0.035	0.015	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
14	B0S6L0	4.87e-08	60.1	1578	0.025	0.019	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
15	A6PWV5	1.68e-07	57.4	409	0.021	0.061	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
16	B7ZP08	1.77e-07	57.4	379	0.021	0.066	B7ZP08_MOUSE AT-rich interactive domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=1
17	A6NKF2	1.98e-07	57.4	412	0.021	0.061	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
18	P09547	3.07e-07	57.4	1314	0.024	0.021	SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWI1 PE=1 SV=1
19	F8WCU9	3.43e-07	57.4	1762	0.023	0.015	F8WCU9_HUMAN AT-rich interaction domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
20	Q62431	6.82e-07	55.8	601	0.021	0.042	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	4e-13	61.2	ARID/BRIGHT DNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352185	0.990	Lysine-specific demethylase PHF2
2	9606.ENSP00000362649	0.793	Histone deacetylase 1
3	9606.ENSP00000285697	0.766	UPF0547 protein C16orf87
4	9606.ENSP00000206513	0.743	CCAAT/enhancer-binding protein epsilon
5	9606.ENSP00000326563	0.689	Lysine-specific demethylase 3B
6	9606.ENSP00000365757	0.688	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
7	9606.ENSP00000331614	0.661	DNA-binding protein Ikaros
8	9606.ENSP00000386660	0.628	Lysine-specific demethylase 3A
9	9606.ENSP00000380692	0.618	Lysine-specific demethylase 7A
10	9606.ENSP00000350676	0.613	Histone lysine demethylase PHF8
11	9606.ENSP00000339484	0.606	Zinc finger AN1-type containing 4
12	9606.ENSP00000364550	0.587	Lysine-specific demethylase 5C
13	9606.ENSP00000378132	0.584	Iroquois-class homeodomain protein IRX-5
14	9606.ENSP00000363431	0.575	Neuropeptide Y receptor type 4
15	9606.ENSP00000263121	0.569	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
16	9606.ENSP00000363482	0.558	WASH complex subunit 2C
17	9606.ENSP00000354652	0.550	Neuropeptide Y receptor type 1
18	9606.ENSP00000395654	0.550	Transcription activator BRG1
19	9606.ENSP00000362650	0.548	Protein SCAI
20	9606.ENSP00000262133	0.538	Retinoblastoma-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0000976	1.000	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0010468	0.975	regulation of gene expression
GO:0048856	0.963	anatomical structure development
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0048519	0.942	negative regulation of biological process
GO:0048523	0.911	negative regulation of cellular process
GO:0009987	0.880	cellular process
GO:0031324	0.866	negative regulation of cellular metabolic process
GO:0010605	0.865	negative regulation of macromolecule metabolic process
GO:0006357	0.860	regulation of transcription by RNA polymerase II
GO:0032501	0.839	multicellular organismal process
GO:0051172	0.836	negative regulation of nitrogen compound metabolic process
GO:0045892	0.665	negative regulation of DNA-templated transcription
GO:0065009	0.557	regulation of molecular function
GO:0007275	0.552	multicellular organism development
GO:0048731	0.423	system development
GO:0048513	0.419	animal organ development
GO:0000122	0.412	negative regulation of transcription by RNA polymerase II
GO:0008152	0.391	metabolic process
GO:0044093	0.363	positive regulation of molecular function
GO:0050896	0.325	response to stimulus
GO:0048518	0.317	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.913	intracellular non-membrane-bounded organelle
GO:0032991	0.770	protein-containing complex
GO:0005737	0.452	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]