StarFunc result for job id Q14872

User Input

>input (753 residues)
MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLED
EDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEG
ATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKA
FLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTF
STQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSELRENSSTTQGQ
DLSTISPAIIFESMFQNSDDTAIQEDPQQTASLTESFNGDAESVSDVPPSTGNSASLSLP
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAA
NHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGA
NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFF
TTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPE
PSPQAPDGPSLQLPAQTFSSAPVPGSSSSTLPSSCEQSRQAETPSDPQTETLSAMDVSEF
LSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14872	0.999	0.999	0.000	753	1.000	1.000	Q14872.pdb.gz	MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens OX=9606 GN=MTF1 PE=1 SV=2
2	AFDB:A8JNP3	0.211	0.163	1.847E-23	1006	0.292	0.219	A8JNP3.pdb.gz	A8JNP3_DROME Metal response element-binding transcription Factor-1, isoform C OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
3	AFDB:Q2EI20	0.202	0.180	2.193E-16	855	0.174	0.153	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
4	AFDB:A0A5K4F1D0	0.146	0.046	1.119E-11	2566	0.179	0.053	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
5	AFDB:Q9Y2X9	0.139	0.118	7.467E-11	895	0.197	0.165	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
6	AFDB:Q9H0D2	0.110	0.065	3.537E-9	1346	0.186	0.104	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
7	AFDB:Q0GGX2	0.127	0.077	5.431E-9	1363	0.169	0.093	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
8	AFDB:Q8I7Z8	0.179	0.140	1.002E-8	990	0.173	0.131	Q8I7Z8.pdb.gz	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
9	AFDB:O75362	0.100	0.082	6.688E-8	1048	0.215	0.155	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
10	AFDB:Q6P9S1	0.104	0.097	5.365E-7	818	0.173	0.159	Q6P9S1.pdb.gz	ATMIN_MOUSE ATM interactor OS=Mus musculus OX=10090 GN=Atmin PE=2 SV=2
11	PDB:6o9lQ	0.041	0.065	3.854E-1	430	0.056	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
12	PDB:7uy7B	0.054	0.095	5.565E-1	291	0.033	0.086	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
13	PDB:7d4iRF	0.044	0.082	1.160	241	0.044	0.137	7d4iRF.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
14	PDB:7ungU	0.034	0.048	1.312	485	0.035	0.054	7ungU.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:4btsA9	0.044	0.171	1.782	93	0.017	0.140	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
16	PDB:7vo0G	0.043	0.147	1.782	131	0.027	0.153	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
17	PDB:4yrvA	0.051	0.102	2.141	288	0.033	0.087	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
18	PDB:6f40P	0.051	0.103	2.276	246	0.025	0.077	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
19	PDB:4wlwA	0.047	0.137	2.908	130	0.023	0.131	4wlwA.pdb.gz	TRANSCRIPTION. Allosteric transcriptional regulation via changes in the overall topology of the core promoter.
20	PDB:6yxyBi	0.051	0.137	3.092	192	0.016	0.062	6yxyBi.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B5H7U7	0.0	586	722	0.393	0.410	A0A0B5H7U7_DANRE Metal regulatory transcription factor 1 isoform X2 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
2	A0A0G2KFP7	0.0	586	749	0.393	0.395	A0A0G2KFP7_DANRE Metal regulatory transcription factor 1 isoform X1 OS=Danio rerio OX=7955 GN=MTF-1 PE=4 SV=2
3	D3ZBT4	0.0	1167	675	0.833	0.929	D3ZBT4_RAT Metal-regulatory transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Mtf1 PE=1 SV=1
4	Q07243	0.0	1162	675	0.829	0.924	MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus OX=10090 GN=Mtf1 PE=1 SV=2
5	Q14872	0.0	1539	753	1.000	1.000	MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens OX=9606 GN=MTF1 PE=1 SV=2
6	Q8QGH4	0.0	583	593	0.393	0.499	Q8QGH4_DANRE Metal regulatory transcription factor 1 OS=Danio rerio OX=7955 GN=MTF-1 PE=2 SV=1
7	X2JCQ6	3.22e-79	273	822	0.163	0.150	X2JCQ6_DROME Metal response element-binding transcription Factor-1, isoform F OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
8	Q9VSY7	1.71e-78	270	791	0.181	0.172	Q9VSY7_DROME Metal response element-binding transcription Factor-1, isoform A OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=2
9	Q9GRX2	1.79e-78	270	791	0.181	0.172	Q9GRX2_DROME Heavy metal-responsive transcription factor-1 OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=2 SV=1
10	Q9NFS1	2.14e-78	270	791	0.181	0.172	Q9NFS1_DROME Heavy metal-responsive transcription factor-1 OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
11	A8JNP3	3.50e-78	273	1006	0.191	0.143	A8JNP3_DROME Metal response element-binding transcription Factor-1, isoform C OS=Drosophila melanogaster OX=7227 GN=MTF-1 PE=4 SV=1
12	O70230	2.42e-49	186	638	0.113	0.133	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
13	Q5XIU2	2.66e-49	186	638	0.113	0.133	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
14	P52747	3.92e-49	185	638	0.112	0.132	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
15	Q1LYE3	7.96e-48	181	623	0.112	0.135	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
16	P36508	4.35e-45	172	570	0.108	0.142	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
17	Q8BMU0	8.43e-45	171	568	0.108	0.143	ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus OX=10090 GN=Znf76 PE=2 SV=1
18	Q86VK4	2.48e-38	151	478	0.090	0.142	ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens OX=9606 GN=ZNF410 PE=1 SV=2
19	Q96NG5	7.25e-35	139	402	0.106	0.199	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
20	Q9UJW8	1.24e-34	143	692	0.108	0.117	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02124 Marek_A	1.9	20.3	Marek's disease glycoprotein A
2	PF00096 zf-C2H2	6.4e-25	97.3	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	9.6e-15	65.0	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	1.2	20.5	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	1.2e-06	40.1	C2H2-type zinc ribbon
6	PF17017 zf-C2H2_aberr	5e+02	12.2	Aberrant zinc-finger
7	PF12171 zf-C2H2_jaz	0.013	27.0	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	7.4e-23	91.1	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356275	0.921	Cysteine and glycine-rich protein 1
2	9606.ENSP00000287936	0.901	3-hydroxy-3-methylglutaryl-coenzyme A reductase
3	9606.ENSP00000308057	0.900	Beta-synuclein
4	9606.ENSP00000355968	0.798	Zinc transporter 1
5	9606.ENSP00000242839	0.714	Copper-transporting ATPase 2
6	9606.ENSP00000363329	0.703	High affinity copper uptake protein 1
7	9606.ENSP00000363394	0.640	Solute carrier family 30 member 2
8	9606.ENSP00000345728	0.624	Copper-transporting ATPase 1
9	9606.ENSP00000378310	0.612	Zinc transporter ZIP8
10	9606.ENSP00000379836	0.563	Zinc transporter 5
11	9606.ENSP00000245185	0.551	Metallothionein-2
12	9606.ENSP00000264451	0.548	Zinc transporter 9
13	9606.ENSP00000430598	0.534	Copper transport protein ATOX1
14	9606.ENSP00000355893	0.530	Zinc transporter 10
15	9606.ENSP00000301305	0.529	Zinc transporter ZIP4
16	9606.ENSP00000478425	0.519	Metallothionein-1A
17	9606.ENSP00000386766	0.511	Zinc transporter ZIP10
18	9606.ENSP00000233535	0.507	Zinc transporter 3
19	9606.ENSP00000384273	0.500	Transcription factor p65

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.994	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0006355	0.979	regulation of DNA-templated transcription
GO:0050896	0.903	response to stimulus
GO:1903508	0.888	positive regulation of nucleic acid-templated transcription
GO:0045893	0.872	positive regulation of DNA-templated transcription
GO:0010038	0.843	response to metal ion
GO:0009987	0.838	cellular process
GO:0045944	0.806	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005654	0.995	nucleoplasm
GO:0016020	0.351	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]