StarFunc result for job id Q14894

User Input

>input (314 residues)
MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLG
VMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT
AAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADT
VQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDEL
MKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDT
VAAKLIYDSWSSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14894	1.000	1.000	3.382E-71	314	1.000	1.000	Q14894.pdb.gz	CRYM_HUMAN Ketimine reductase mu-crystallin OS=Homo sapiens OX=9606 GN=CRYM PE=1 SV=1
2	AFDB:O54983	0.989	0.993	5.844E-64	313	0.882	0.885	O54983.pdb.gz	CRYM_MOUSE Ketimine reductase mu-crystallin OS=Mus musculus OX=10090 GN=Crym PE=1 SV=1
3	PDB:2i99A	0.980	0.986	8.860E-63	312	0.994	1.000	2i99A.pdb.gz	Crystal structure of human {micro}-crystallin complexed with NADPH
4	AFDB:Q9FLY0	0.860	0.833	7.632E-30	325	0.287	0.277	Q9FLY0.pdb.gz	SARD4_ARATH Protein SAR DEFICIENT 4 OS=Arabidopsis thaliana OX=3702 GN=SARD4 PE=1 SV=1
5	AFDB:O28608	0.893	0.872	1.314E-29	322	0.315	0.307	O28608.pdb.gz	ALADH_ARCFU Alanine dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=ala PE=1 SV=1
6	AFDB:Q9HDZ0	0.864	0.825	1.777E-29	330	0.312	0.297	Q9HDZ0.pdb.gz	YK01_SCHPO Uncharacterized protein P11E10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP11E10.01 PE=3 SV=1
7	PDB:1vllA	0.881	0.863	8.487E-28	321	0.318	0.312	1vllA.pdb.gz
8	PDB:6rqaA	0.848	0.829	4.889E-27	322	0.255	0.248	6rqaA.pdb.gz	Marine Proteobacteria metabolize glycolate via the beta-hydroxyaspartate cycle.
9	AFDB:A1B8Z0	0.889	0.873	4.557E-26	320	0.239	0.234	A1B8Z0.pdb.gz	BHCD_PARDP Iminosuccinate reductase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=bhcD PE=1 SV=1
10	AFDB:Q2G1N2	0.898	0.841	8.336E-26	336	0.245	0.229	Q2G1N2.pdb.gz	SBNB_STAA8 N-((2S)-2-amino-2-carboxyethyl)-L-glutamate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sbnB PE=1 SV=1
11	AFDB:Q9HXE4	0.846	0.843	4.256E-25	315	0.217	0.216	Q9HXE4.pdb.gz	DAUB_PSEAE NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dauB PE=1 SV=1
12	PDB:2hk9A	0.292	0.331	6.340E-7	269	0.134	0.156	2hk9A.pdb.gz	Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism.
13	AFDB:P0A6X1	0.304	0.240	6.724E-7	418	0.131	0.098	P0A6X1.pdb.gz	HEM1_ECOLI Glutamyl-tRNA reductase OS=Escherichia coli (strain K12) OX=83333 GN=hemA PE=1 SV=1
14	AFDB:O67049	0.317	0.363	1.090E-6	269	0.121	0.141	O67049.pdb.gz	AROE_AQUAE Shikimate dehydrogenase (NADP(+)) OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aroE PE=1 SV=1
15	PDB:1nytA	0.338	0.383	1.222E-5	271	0.105	0.122	1nytA.pdb.gz	Structures of shikimate dehydrogenase AroE and its Paralog YdiB. A common structural framework for different activities.
16	PDB:1npdB	0.319	0.343	2.522E-5	288	0.102	0.111	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
17	PDB:2fssA	0.291	0.263	3.623E-5	353	0.108	0.096	2fssA.pdb.gz
18	PDB:4p4gA	0.290	0.330	4.612E-5	265	0.118	0.140	4p4gA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Shikimate Dehydrogenase
19	PDB:1sc6D	0.281	0.235	6.626E-5	384	0.115	0.094	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
20	PDB:2ev9B	0.302	0.351	6.626E-5	263	0.108	0.129	2ev9B.pdb.gz	Crystal Structures of Shikimate Dehydrogenase AroE from Thermus thermophilus HB8 and its Cofactor and Substrate Complexes: Insights into the Enzymatic Mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54983	0.0	576	313	0.885	0.888	CRYM_MOUSE Ketimine reductase mu-crystallin OS=Mus musculus OX=10090 GN=Crym PE=1 SV=1
2	Q14894	0.0	640	314	1.000	1.000	CRYM_HUMAN Ketimine reductase mu-crystallin OS=Homo sapiens OX=9606 GN=CRYM PE=1 SV=1
3	Q9QYU4	0.0	574	313	0.879	0.882	CRYM_RAT Ketimine reductase mu-crystallin OS=Rattus norvegicus OX=10116 GN=Crym PE=1 SV=1
4	I3L325	2.33e-178	494	241	0.768	1.000	I3L325_HUMAN Ketimine reductase mu-crystallin (Fragment) OS=Homo sapiens OX=9606 GN=CRYM PE=1 SV=1
5	I3NI53	4.29e-97	284	140	0.446	1.000	I3NI53_HUMAN Ketimine reductase mu-crystallin (Fragment) OS=Homo sapiens OX=9606 GN=CRYM PE=1 SV=1
6	O28608	3.33e-36	134	322	0.290	0.283	ALADH_ARCFU Alanine dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=ala PE=1 SV=1
7	Q9FLY0	6.72e-31	120	325	0.268	0.258	SARD4_ARATH Protein SAR DEFICIENT 4 OS=Arabidopsis thaliana OX=3702 GN=SARD4 PE=1 SV=1
8	Q9HDZ0	5.15e-28	112	330	0.274	0.261	YK01_SCHPO Uncharacterized protein P11E10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP11E10.01 PE=3 SV=1
9	A1B8Z0	7.92e-27	109	320	0.229	0.225	BHCD_PARDP Iminosuccinate reductase OS=Paracoccus denitrificans (strain Pd 1222) OX=318586 GN=bhcD PE=1 SV=1
10	Q2G1N2	5.27e-18	85.1	336	0.255	0.238	SBNB_STAA8 N-((2S)-2-amino-2-carboxyethyl)-L-glutamate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sbnB PE=1 SV=1
11	Q9HXE4	2.98e-07	53.5	315	0.210	0.210	DAUB_PSEAE NAD(P)H-dependent anabolic L-arginine dehydrogenase DauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=dauB PE=1 SV=1
12	P0A6X1	0.031	38.1	418	0.080	0.060	HEM1_ECOLI Glutamyl-tRNA reductase OS=Escherichia coli (strain K12) OX=83333 GN=hemA PE=1 SV=1
13	Q9LX66	5.9	31.2	830	0.092	0.035	HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana OX=3702 GN=HERK1 PE=1 SV=1
14	A8K8M5	8.8	30.4	578	0.048	0.026	A8K8M5_HUMAN G protein-coupled receptor kinase OS=Homo sapiens OX=9606 PE=2 SV=1
15	P32298	9.0	30.4	578	0.048	0.026	GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens OX=9606 GN=GRK4 PE=1 SV=3
16	P38337	9.7	29.3	142	0.067	0.148	SHG1_YEAST COMPASS component SHG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHG1 PE=1 SV=1
17	P23327	9.8	30.4	699	0.051	0.023	SRCH_HUMAN Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03807 F420_oxidored	0.31	23.0	NADP oxidoreductase coenzyme F420-dependent
2	PF09394 Inhibitor_I42	5.2e+02	12.5	Chagasin family peptidase inhibitor I42
3	PF03446 NAD_binding_2	0.54	21.9	NAD binding domain of 6-phosphogluconate dehydrogenase
4	PF02423 OCD_Mu_crystall	6.3e-116	398.4	Ornithine cyclodeaminase/mu-crystallin family
5	PF00185 OTCace	2.3e+02	13.2	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
6	PF01488 Shikimate_DH	4.9e-07	41.3	Shikimate / quinate 5-dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317721	0.933	Peroxisomal sarcosine oxidase
2	9606.ENSP00000205214	0.766	Acyl-CoA synthetase family member 4
3	9606.ENSP00000370966	0.746	Quinone oxidoreductase-like protein 1
4	9606.ENSP00000316909	0.705	Vesicular glutamate transporter 3
5	9606.ENSP00000269503	0.685	Cerebellin-2
6	9606.ENSP00000237014	0.683	Transthyretin
7	9606.ENSP00000247194	0.682	Trans-3-hydroxy-L-proline dehydratase
8	9606.ENSP00000298248	0.667	Lambda-crystallin homolog
9	9606.ENSP00000316338	0.651	Brain-specific angiogenesis inhibitor 1-associated protein 2
10	9606.ENSP00000329374	0.648	Thyroxine-binding globulin
11	9606.ENSP00000359085	0.642	Netrin-G1
12	9606.ENSP00000358765	0.633	Trophoblast glycoprotein
13	9606.ENSP00000263985	0.630	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
14	9606.ENSP00000356545	0.619	Voltage-dependent R-type calcium channel subunit alpha-1E
15	9606.ENSP00000376921	0.604	Netrin-G2
16	9606.ENSP00000399805	0.603	Quinone oxidoreductase
17	9606.ENSP00000268150	0.593	Lactadherin
18	9606.ENSP00000444210	0.591	Retinoic acid induced 2
19	9606.ENSP00000232564	0.590	Guanine nucleotide-binding protein subunit beta-4
20	9606.ENSP00000216259	0.585	Phosphomannomutase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042562	1.000	hormone binding
GO:0016491	1.000	oxidoreductase activity
GO:0097159	0.996	organic cyclic compound binding
GO:0042802	0.996	identical protein binding
GO:1901363	0.992	heterocyclic compound binding
GO:0036094	0.991	small molecule binding
GO:0016646	0.982	oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
GO:0030554	0.982	adenyl nucleotide binding
GO:0046983	0.979	protein dimerization activity
GO:0042803	0.946	protein homodimerization activity
GO:0050661	0.773	NADP binding
GO:0003712	0.765	transcription coregulator activity
GO:0003714	0.744	transcription corepressor activity
GO:0070324	0.483	thyroid hormone binding
GO:0047127	0.465	thiomorpholine-carboxylate dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0071704	0.977	organic substance metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0065007	0.931	biological regulation
GO:0006807	0.791	nitrogen compound metabolic process
GO:1901564	0.718	organonitrogen compound metabolic process
GO:0050789	0.546	regulation of biological process
GO:0051179	0.507	localization
GO:0006810	0.495	transport
GO:0044238	0.433	primary metabolic process
GO:0050794	0.396	regulation of cellular process
GO:0050896	0.310	response to stimulus
GO:0032501	0.301	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.987	intracellular organelle
GO:0043227	0.986	membrane-bounded organelle
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0070013	0.972	intracellular organelle lumen
GO:0005576	0.841	extracellular region
GO:0031982	0.726	vesicle
GO:1903561	0.603	extracellular vesicle
GO:0016020	0.575	membrane
GO:0005615	0.570	extracellular space
GO:0005634	0.548	nucleus
GO:0070062	0.515	extracellular exosome
GO:0031981	0.418	nuclear lumen
GO:0042579	0.313	microbody

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.5.1.-	0.982	With NAD(+) or NADP(+) as acceptor.
EC:1.5.1.25	0.465	thiomorpholine-carboxylate dehydrogenase.

[back to server]