StarFunc result for job id Q14896

User Input

>input (1274 residues)
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA
PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE
VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK
KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK
KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT
LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE
GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV
QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK
LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV
VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE
TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI
SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV
VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG
LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE
PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS
IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL
NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF
SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML
CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG
EARCECRLEVRVPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1L1QZU5	0.378	0.375	0.000	1287	0.629	0.622	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	AFDB:A0A571BEN1	0.226	0.250	0.000	1139	0.439	0.491	A0A571BEN1.pdb.gz	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	AFDB:A5WWB7	0.256	0.281	0.000	1147	0.431	0.479	A5WWB7.pdb.gz
4	AFDB:A6QP89	0.318	0.333	0.000	1198	0.458	0.487	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
5	AFDB:E7EZ79	0.348	0.349	0.000	1266	0.620	0.624	E7EZ79.pdb.gz
6	AFDB:F1R6I7	0.340	0.382	0.000	1111	0.485	0.556	F1R6I7.pdb.gz
7	AFDB:P16419	0.343	0.378	0.000	1132	0.495	0.557	P16419.pdb.gz	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
8	AFDB:P56741	0.594	0.594	0.000	1274	0.889	0.889	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
9	AFDB:Q14324	0.306	0.333	0.000	1141	0.487	0.544	Q14324.pdb.gz	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
10	AFDB:Q14896	1.000	1.000	0.000	1274	1.000	1.000	Q14896.pdb.gz	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
11	PDB:1e07A	0.141	0.226	3.439E-21	642	0.086	0.171	1e07A.pdb.gz
12	PDB:5oj2B	0.079	0.132	2.918E-20	692	0.108	0.199	5oj2B.pdb.gz
13	PDB:7sqcO0	0.118	0.129	2.101E-18	1140	0.075	0.083	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:4edqA	0.088	0.228	1.074E-15	483	0.081	0.213	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
15	PDB:5a42A	0.077	0.068	7.975E-15	1597	0.086	0.069	5a42A.pdb.gz
16	PDB:7q1yA	0.103	0.097	5.180E-14	1374	0.075	0.070	7q1yA.pdb.gz
17	PDB:4ziqA	0.077	0.072	7.843E-13	1450	0.082	0.072	4ziqA.pdb.gz
18	PDB:7q5zA	0.092	0.089	9.373E-13	1344	0.071	0.068	7q5zA.pdb.gz
19	PDB:4lnvA	0.075	0.075	1.025E-12	1276	0.068	0.068	4lnvA.pdb.gz
20	PDB:7vonA	0.082	0.076	9.504E-12	1399	0.070	0.064	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L1QZU5	0.0	1629	1287	0.633	0.627	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	A0A571BEN1	0.0	1156	1139	0.447	0.500	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	A6QP89	0.0	1125	1198	0.452	0.481	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
4	D3YU50	0.0	1160	1127	0.448	0.507	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
5	F6RQD1	0.0	608	626	0.232	0.471	F6RQD1_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
6	O70468	0.0	2330	1270	0.889	0.892	MYPC3_MOUSE Myosin-binding protein C, cardiac-type OS=Mus musculus OX=10090 GN=Mybpc3 PE=1 SV=1
7	P16419	0.0	1243	1132	0.492	0.554	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
8	P56741	0.0	2324	1274	0.892	0.892	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
9	Q00872	0.0	1157	1141	0.443	0.495	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
10	Q14324	0.0	1223	1141	0.492	0.550	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
11	Q14896	0.0	2625	1274	1.000	1.000	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
12	Q5BJ14	0.0	1249	1111	0.485	0.556	Q5BJ14_DANRE Zgc:110761 OS=Danio rerio OX=7955 GN=zgc:110761 PE=2 SV=1
13	Q5U3B1	0.0	1103	1168	0.432	0.472	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
14	Q5XKE0	0.0	1210	1136	0.486	0.545	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
15	Q63518	0.0	564	621	0.217	0.444	MYPC1_RAT Myosin-binding protein C, slow-type (Fragment) OS=Rattus norvegicus OX=10116 GN=Mybpc1 PE=1 SV=1
16	Q6P6L5	0.0	1160	1124	0.445	0.504	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
17	Q86T42	0.0	713	783	0.284	0.462	Q86T42_HUMAN Uncharacterized protein DKFZp451E186 OS=Homo sapiens OX=9606 GN=DKFZp451E186 PE=2 SV=1
18	Q90688	0.0	1835	1272	0.690	0.691	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
19	Q13203	1.23e-138	432	477	0.166	0.442	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4
20	F7D574	2.97e-137	424	362	0.147	0.517	F7D574_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.025	26.3	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	7.1e-06	37.3	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	4.3e-36	134.5	Fibronectin type III domain
4	PF20418 Herpes_gE_N	1.3e+02	13.9	Alphaherpesvirus glycoprotein E N-terminal
5	PF07679 I-set	1.2e-104	353.9	Immunoglobulin I-set domain
6	PF00047 ig	2.9e-31	118.8	Immunoglobulin domain
7	PF13895 Ig_2	2.5e-26	103.1	Immunoglobulin domain
8	PF13927 Ig_3	2.5e-63	221.9	Immunoglobulin domain
9	PF16681 Ig_5	0.35	22.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF09134 Invasin_D3	8.7	18.2	Invasin, domain 3
11	PF16706 Izumo-Ig	7.8	17.8	Izumo-like Immunoglobulin domain
12	PF16820 PKD_3	3.2	19.0	PKD-like domain
13	PF18362 THB	9.3e-18	74.8	Tri-helix bundle domain
14	PF07686 V-set	4.3e-19	80.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442795

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347507	0.992	Myosin-7
2	9606.ENSP00000386041	0.987	Myosin-6
3	9606.ENSP00000236918	0.967	Troponin T, cardiac muscle
4	9606.ENSP00000341838	0.946	Troponin I, cardiac muscle
5	9606.ENSP00000228841	0.938	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
6	9606.ENSP00000379210	0.937	Myosin light chain 3
7	9606.ENSP00000351022	0.932	Tropomyosin alpha-1 chain
8	9606.ENSP00000290378	0.905	Actin, alpha cardiac muscle 1
9	9606.ENSP00000312624	0.905	Telethonin
10	9606.ENSP00000350332	0.904	Myosin-binding protein C, fast-type
11	9606.ENSP00000400908	0.903	Myosin-binding protein C, slow-type
12	9606.ENSP00000467141	0.875	Titin
13	9606.ENSP00000443495	0.858	Alpha-actinin-2
14	9606.ENSP00000458162	0.848	Actin, cytoplasmic 2
15	9606.ENSP00000284770	0.846	PDZ and LIM domain protein 3
16	9606.ENSP00000357516	0.838	Tropomyosin alpha-3 chain
17	9606.ENSP00000431813	0.825	Cysteine and glycine-rich protein 3
18	9606.ENSP00000306997	0.822	Myozenin-2
19	9606.ENSP00000354488	0.810	Troponin I, slow skeletal muscle
20	9606.ENSP00000347055	0.807	Myosin light chain 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032036	0.999	myosin heavy chain binding
GO:0008307	0.997	structural constituent of muscle
GO:0042802	0.979	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0048856	0.989	anatomical structure development
GO:0050789	0.988	regulation of biological process
GO:0006936	0.978	muscle contraction
GO:0061061	0.973	muscle structure development
GO:0006941	0.967	striated muscle contraction
GO:0044057	0.965	regulation of system process
GO:0060048	0.959	cardiac muscle contraction
GO:0009653	0.953	anatomical structure morphogenesis
GO:0048513	0.945	animal organ development
GO:0007275	0.941	multicellular organism development
GO:0048731	0.916	system development
GO:0009987	0.913	cellular process
GO:0006942	0.910	regulation of striated muscle contraction
GO:0007507	0.837	heart development
GO:0007517	0.791	muscle organ development
GO:0060537	0.735	muscle tissue development
GO:0003205	0.716	cardiac chamber development
GO:0050794	0.611	regulation of cellular process
GO:0008016	0.601	regulation of heart contraction
GO:0048738	0.571	cardiac muscle tissue development
GO:0003007	0.554	heart morphogenesis
GO:0065008	0.545	regulation of biological quality
GO:0048644	0.536	muscle organ morphogenesis
GO:0003229	0.475	ventricular cardiac muscle tissue development
GO:0060415	0.438	muscle tissue morphogenesis
GO:0055008	0.430	cardiac muscle tissue morphogenesis
GO:0071840	0.391	cellular component organization or biogenesis
GO:0030029	0.349	actin filament-based process
GO:0016043	0.337	cellular component organization
GO:0050896	0.316	response to stimulus
GO:0003206	0.313	cardiac chamber morphogenesis
GO:0055001	0.307	muscle cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	1.000	sarcomere
GO:0005829	0.883	cytosol
GO:0005856	0.807	cytoskeleton
GO:0036379	0.655	myofilament
GO:0032982	0.574	myosin filament
GO:0031672	0.567	A band
GO:0043227	0.553	membrane-bounded organelle
GO:0005863	0.487	striated muscle myosin thick filament
GO:0032991	0.455	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]