StarFunc result for job id Q14916

User Input

>input (467 residues)
MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTS
TKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSV
LSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLL
GPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSS
TFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI
LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14916	1.000	1.000	1.777E-58	467	1.000	1.000	Q14916.pdb.gz	NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens OX=9606 GN=SLC17A1 PE=1 SV=2
2	AFDB:Q62795	0.846	0.849	2.884E-40	465	0.651	0.654	Q62795.pdb.gz	NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus OX=10116 GN=Slc17a1 PE=2 SV=1
3	AFDB:E9PTR8	0.807	0.762	2.890E-32	498	0.478	0.448	E9PTR8.pdb.gz	E9PTR8_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=2
4	AFDB:Q9Y2C5	0.778	0.736	1.444E-30	497	0.471	0.443	Q9Y2C5.pdb.gz	S17A4_HUMAN Probable small intestine urate exporter OS=Homo sapiens OX=9606 GN=SLC17A4 PE=1 SV=1
5	AFDB:A0A0G2JX26	0.880	0.877	1.062E-29	469	0.441	0.439	A0A0G2JX26.pdb.gz	A0A0G2JX26_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=1
6	AFDB:B2RE38	0.937	0.885	6.418E-29	495	0.364	0.343	B2RE38.pdb.gz	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q5Q0U0	0.934	0.882	9.491E-29	495	0.353	0.333	Q5Q0U0.pdb.gz	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
8	AFDB:O00624	0.734	0.776	7.013E-27	439	0.437	0.465	O00624.pdb.gz	NPT3_HUMAN Sodium-dependent phosphate transport protein 3 OS=Homo sapiens OX=9606 GN=SLC17A2 PE=2 SV=2
9	AFDB:O00476	0.770	0.854	2.550E-26	420	0.405	0.450	O00476.pdb.gz	NPT4_HUMAN Sodium-dependent phosphate transport protein 4 OS=Homo sapiens OX=9606 GN=SLC17A3 PE=1 SV=2
10	AFDB:Q1L8X9	0.892	0.710	1.482E-25	590	0.315	0.249	Q1L8X9.pdb.gz	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
11	PDB:7sptA	0.654	0.650	5.107E-9	470	0.135	0.134	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
12	PDB:6thaA	0.608	0.631	1.306E-8	448	0.148	0.154	6thaA.pdb.gz
13	PDB:3o7qA	0.626	0.696	2.969E-8	414	0.150	0.169	3o7qA.pdb.gz
14	PDB:4ybqB	0.639	0.645	3.472E-8	462	0.137	0.139	4ybqB.pdb.gz
15	PDB:4gbyA	0.663	0.653	4.566E-8	475	0.161	0.158	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7wsmA	0.591	0.594	6.003E-8	464	0.141	0.142	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
17	PDB:7bc7A	0.565	0.604	7.020E-8	432	0.146	0.157	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
18	PDB:6s4mA	0.616	0.668	2.183E-7	426	0.128	0.141	6s4mA.pdb.gz
19	PDB:6oopA	0.593	0.688	2.270E-7	392	0.120	0.143	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
20	PDB:7zh0A	0.627	0.597	2.760E-7	495	0.133	0.125	7zh0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14916	0.0	947	467	1.000	1.000	NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens OX=9606 GN=SLC17A1 PE=1 SV=2
2	Q62795	0.0	613	465	0.651	0.654	NPT1_RAT Sodium-dependent phosphate transport protein 1 OS=Rattus norvegicus OX=10116 GN=Slc17a1 PE=2 SV=1
3	Q8CJH9	5.49e-150	438	498	0.482	0.452	Q8CJH9_RAT Na/Pi cotransporter 4 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=2 SV=1
4	E9PTR8	5.80e-150	438	498	0.482	0.452	E9PTR8_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=2
5	Q9Y2C5	7.71e-149	435	497	0.478	0.449	S17A4_HUMAN Probable small intestine urate exporter OS=Homo sapiens OX=9606 GN=SLC17A4 PE=1 SV=1
6	O00624	1.01e-138	407	439	0.445	0.474	NPT3_HUMAN Sodium-dependent phosphate transport protein 3 OS=Homo sapiens OX=9606 GN=SLC17A2 PE=2 SV=2
7	Q6AZ69	4.12e-136	402	475	0.454	0.446	Q6AZ69_RAT Slc17a3 protein OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=1 SV=1
8	A0A0G2JX26	8.21e-130	385	469	0.443	0.441	A0A0G2JX26_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=4 SV=1
9	O00476	4.00e-120	359	420	0.415	0.462	NPT4_HUMAN Sodium-dependent phosphate transport protein 4 OS=Homo sapiens OX=9606 GN=SLC17A3 PE=1 SV=2
10	A0A0G2JY28	4.50e-113	341	420	0.403	0.448	A0A0G2JY28_RAT Solute carrier family 17 member 3 OS=Rattus norvegicus OX=10116 GN=Slc17a3 PE=1 SV=1
11	Q9NRA2	3.65e-96	300	495	0.381	0.360	S17A5_HUMAN Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2
12	B2RE38	1.64e-93	293	495	0.377	0.356	B2RE38_HUMAN cDNA, FLJ96906, highly similar to Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q5Q0U0	8.42e-92	289	495	0.362	0.341	S17A5_RAT Sialin OS=Rattus norvegicus OX=10116 GN=Slc17a5 PE=1 SV=1
14	Q8BN82	1.64e-91	288	495	0.366	0.345	S17A5_MOUSE Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2
15	Q1L8X9	7.35e-72	239	590	0.298	0.236	VGLU3_DANRE Vesicular glutamate transporter 3 OS=Danio rerio OX=7955 GN=slc17a8 PE=3 SV=2
16	Q8NDX2	7.72e-71	237	589	0.296	0.234	VGLU3_HUMAN Vesicular glutamate transporter 3 OS=Homo sapiens OX=9606 GN=SLC17A8 PE=1 SV=1
17	Q9P2U8	9.48e-71	236	582	0.289	0.232	VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens OX=9606 GN=SLC17A6 PE=2 SV=1
18	Q62634	1.60e-70	235	560	0.281	0.234	VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc17a7 PE=1 SV=1
19	Q8BLE7	2.08e-70	236	582	0.304	0.244	VGLU2_MOUSE Vesicular glutamate transporter 2 OS=Mus musculus OX=10090 GN=Slc17a6 PE=1 SV=1
20	Q9JI12	2.17e-70	236	582	0.304	0.244	VGLU2_RAT Vesicular glutamate transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc17a6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	1.5e-44	164.1	Major Facilitator Superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394485	0.892	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
2	9606.ENSP00000301891	0.881	Solute carrier family 22 member 11
3	9606.ENSP00000366797	0.876	Solute carrier family 22 member 12
4	9606.ENSP00000264784	0.863	Solute carrier family 2, facilitated glucose transporter member 9
5	9606.ENSP00000371483	0.822	Sodium-dependent phosphate transport protein 2B
6	9606.ENSP00000275227	0.817	MFS-type transporter SLC18B1
7	9606.ENSP00000321424	0.786	Sodium-dependent phosphate transport protein 2A
8	9606.ENSP00000387549	0.771	Chromaffin granule amine transporter
9	9606.ENSP00000337335	0.747	Solute carrier family 22 member 8
10	9606.ENSP00000378757	0.741	Monocarboxylate transporter 9
11	9606.ENSP00000367102	0.726	Solute carrier family 22 member 6
12	9606.ENSP00000331983	0.710	F-actin-uncapping protein LRRC16A
13	9606.ENSP00000310241	0.708	Solute carrier family 22 member 13
14	9606.ENSP00000237612	0.693	ATP-binding cassette sub-family G member 2
15	9606.ENSP00000441065	0.653	Monocarboxylate transporter 1
16	9606.ENSP00000272542	0.643	Sodium-dependent phosphate transporter 1
17	9606.ENSP00000442397	0.642	Sodium-dependent phosphate transport protein 2C
18	9606.ENSP00000340465	0.635	Sodium-dependent phosphate transporter 2
19	9606.ENSP00000401508	0.630	Nicotinate phosphoribosyltransferase
20	9606.ENSP00000279178	0.606	Solute carrier family 22 member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005436	1.000	sodium:phosphate symporter activity
GO:0008514	0.695	organic anion transmembrane transporter activity
GO:0005488	0.637	binding
GO:0005342	0.622	organic acid transmembrane transporter activity
GO:0046943	0.614	carboxylic acid transmembrane transporter activity
GO:0005515	0.485	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.995	localization
GO:0006810	0.994	transport
GO:0009987	0.983	cellular process
GO:0008152	0.933	metabolic process
GO:0006811	0.920	monoatomic ion transport
GO:0044237	0.872	cellular metabolic process
GO:0015698	0.768	inorganic anion transport
GO:0071702	0.751	organic substance transport
GO:0006817	0.736	phosphate ion transport
GO:0015711	0.710	organic anion transport
GO:0071704	0.628	organic substance metabolic process
GO:0006807	0.551	nitrogen compound metabolic process
GO:1901564	0.421	organonitrogen compound metabolic process
GO:0044238	0.339	primary metabolic process
GO:0071705	0.337	nitrogen compound transport
GO:1901360	0.311	organic cyclic compound metabolic process
GO:0046483	0.300	heterocycle metabolic process
GO:0006725	0.300	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0045177	0.980	apical part of cell
GO:0016324	0.974	apical plasma membrane
GO:0043227	0.780	membrane-bounded organelle
GO:0005622	0.521	intracellular anatomical structure
GO:0043229	0.496	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]