StarFunc result for job id Q14919

User Input

>input (205 residues)
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDEEDEEDYDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14919	0.999	0.999	8.376E-29	205	1.000	1.000	Q14919.pdb.gz	NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3
2	AFDB:Q9GSP1	0.414	0.252	3.294E-12	341	0.405	0.243	Q9GSP1.pdb.gz	Q9GSP1_DROME LD24434p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=1
3	AFDB:F4K162	0.418	0.327	8.727E-11	264	0.420	0.326	F4K162.pdb.gz	F4K162_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g19490 PE=1 SV=1
4	AFDB:Q10315	0.535	0.549	1.118E-10	199	0.322	0.332	Q10315.pdb.gz	BUR6_SCHPO Transcription regulator complex subunit bur6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bur6 PE=3 SV=1
5	AFDB:Q8W0W7	0.400	0.320	6.714E-10	258	0.341	0.271	Q8W0W7.pdb.gz	Q8W0W7_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=DrAp1 PE=1 SV=1
6	AFDB:Q9LHG0	0.400	0.281	7.597E-10	293	0.332	0.232	Q9LHG0.pdb.gz	Q9LHG0_ARATH At3g12480/MQC3.32 OS=Arabidopsis thaliana OX=3702 GN=NF-YC11 PE=1 SV=1
7	AFDB:O59849	0.380	0.296	2.352E-6	265	0.180	0.140	O59849.pdb.gz	O59849_ASPOZ HAPE OS=Aspergillus oryzae OX=5062 GN=hapE PE=4 SV=1
8	AFDB:C8V0B5	0.379	0.295	3.012E-6	265	0.180	0.140	C8V0B5.pdb.gz	C8V0B5_EMENI HapE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06492 PE=1 SV=1
9	AFDB:A6BLW4	0.403	0.339	4.643E-6	246	0.210	0.175	A6BLW4.pdb.gz	NFYC2_ORYSJ Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1
10	AFDB:Q7ZVY3	0.371	0.218	8.100E-6	360	0.180	0.103	Q7ZVY3.pdb.gz	Q7ZVY3_DANRE Nfyc protein OS=Danio rerio OX=7955 GN=fb98f01 PE=1 SV=1
11	PDB:5y26B	0.366	0.782	4.120E-5	92	0.132	0.293	5y26B.pdb.gz
12	PDB:1id3C	0.345	0.581	2.633E-4	110	0.078	0.145	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
13	PDB:5z30G	0.340	0.586	4.318E-4	110	0.117	0.218	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
14	PDB:6wjv3	0.334	0.747	2.026E-3	85	0.102	0.247	6wjv3.pdb.gz
15	PDB:2rvqC	0.306	0.449	2.594E-3	133	0.088	0.135	2rvqC.pdb.gz
16	PDB:6m4gC	0.308	0.633	8.934E-3	90	0.049	0.111	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
17	PDB:5y27A	0.326	0.628	1.011E-2	98	0.054	0.112	5y27A.pdb.gz
18	PDB:1jfiB	0.354	0.523	1.144E-2	135	0.078	0.119	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
19	PDB:7pj1A	0.316	0.496	1.764E-2	123	0.093	0.154	7pj1A.pdb.gz
20	PDB:2bykA	0.263	0.694	2.259E-2	72	0.078	0.222	2bykA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14919	2.07e-150	417	205	1.000	1.000	NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens OX=9606 GN=DRAP1 PE=1 SV=3
2	Q9D6N5	4.58e-126	355	205	0.932	0.932	NC2A_MOUSE Dr1-associated corepressor OS=Mus musculus OX=10090 GN=Drap1 PE=1 SV=3
3	Q9W2E3	1.44e-41	145	341	0.332	0.199	Q9W2E3_DROME Negative cofactor 2alpha OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=2
4	Q9GSP1	1.54e-41	145	341	0.332	0.199	Q9GSP1_DROME LD24434p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=1
5	F4K162	5.03e-33	121	264	0.293	0.227	F4K162_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At5g19490 PE=1 SV=1
6	Q9LHG0	3.25e-31	117	293	0.268	0.188	Q9LHG0_ARATH At3g12480/MQC3.32 OS=Arabidopsis thaliana OX=3702 GN=NF-YC11 PE=1 SV=1
7	Q8W0W7	9.76e-30	112	258	0.239	0.190	Q8W0W7_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=DrAp1 PE=1 SV=1
8	Q10315	7.92e-29	108	199	0.220	0.226	BUR6_SCHPO Transcription regulator complex subunit bur6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bur6 PE=3 SV=1
9	Q8MLV5	8.67e-28	108	321	0.244	0.156	Q8MLV5_DROME GH27814p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=2 SV=1
10	P40096	3.09e-18	79.3	142	0.176	0.254	NCB1_YEAST Negative cofactor 2 complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUR6 PE=1 SV=1
11	Q6FM95	5.92e-12	63.9	201	0.122	0.124	Q6FM95_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HAP5 PE=4 SV=1
12	Q9ZVL3	6.88e-11	61.6	217	0.132	0.124	NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana OX=3702 GN=NFYC3 PE=1 SV=1
13	Q02516	8.25e-11	61.6	242	0.127	0.107	HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP5 PE=1 SV=1
14	Q9XE33	1.25e-10	60.5	205	0.141	0.141	NFYC6_ORYSJ Nuclear transcription factor Y subunit C-6 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC6 PE=1 SV=1
15	Q8L4B2	1.73e-10	60.5	231	0.132	0.117	NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana OX=3702 GN=NFYC9 PE=1 SV=1
16	Q655V5	5.69e-10	59.3	250	0.132	0.108	NFYC4_ORYSJ Nuclear transcription factor Y subunit C-4 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC4 PE=1 SV=1
17	Q8LCG7	8.88e-10	58.2	199	0.137	0.141	NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana OX=3702 GN=NFYC2 PE=1 SV=2
18	Q9FMV5	2.29e-09	57.8	250	0.127	0.104	NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana OX=3702 GN=NFYC4 PE=1 SV=1
19	Q9SMP0	2.79e-09	57.0	234	0.127	0.111	NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1
20	A6BLW4	2.89e-09	57.4	246	0.132	0.110	NFYC2_ORYSJ Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	7.4e-16	69.5	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF12235 FXMRP1_C_core	4.4	19.4	Fragile X-related 1 protein core C terminal
3	PF00125 Histone	0.026	26.2	Core histone H2A/H2B/H3/H4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359295	0.999	Protein Dr1
2	9606.ENSP00000375942	0.975	TATA-box-binding protein
3	9606.ENSP00000366534	0.973	Forkhead box protein H1
4	9606.ENSP00000262160	0.942	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000265990	0.936	TATA-binding protein-associated factor 172
6	9606.ENSP00000341551	0.927	Mothers against decapentaplegic homolog 4
7	9606.ENSP00000332973	0.900	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000240055	0.861	Nuclear transcription factor Y subunit beta
9	9606.ENSP00000359531	0.859	Transcription initiation factor IIB
10	9606.ENSP00000247219	0.756	TATA box-binding protein-like protein 2
11	9606.ENSP00000370193	0.752	Transcription initiation factor TFIID subunit 9
12	9606.ENSP00000363286	0.732	DNA polymerase epsilon subunit 3
13	9606.ENSP00000262498	0.729	Cilia- and flagella-associated protein 20
14	9606.ENSP00000360200	0.666	InaD-like protein
15	9606.ENSP00000290921	0.651	C-terminal-binding protein 1
16	9606.ENSP00000339917	0.633	Transcription initiation factor TFIID subunit 9B
17	9606.ENSP00000261332	0.620	Zinc finger protein 24
18	9606.ENSP00000220913	0.600	Chromatin accessibility complex protein 1
19	9606.ENSP00000354487	0.573	Zinc finger E-box-binding homeobox 1
20	9606.ENSP00000354633	0.567	Transcription initiation factor TFIID subunit 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140223	1.000	general transcription initiation factor activity
GO:0001098	1.000	basal transcription machinery binding
GO:0140296	1.000	general transcription initiation factor binding
GO:0003712	0.999	transcription coregulator activity
GO:0003677	0.999	DNA binding
GO:0016251	0.994	RNA polymerase II general transcription initiation factor activity
GO:0042802	0.994	identical protein binding
GO:0001099	0.986	basal RNA polymerase II transcription machinery binding
GO:0017025	0.985	TBP-class protein binding
GO:0001091	0.983	RNA polymerase II general transcription initiation factor binding
GO:0003714	0.825	transcription corepressor activity
GO:0043565	0.393	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0010468	0.994	regulation of gene expression
GO:0010556	0.990	regulation of macromolecule biosynthetic process
GO:0031326	0.990	regulation of cellular biosynthetic process
GO:0051252	0.988	regulation of RNA metabolic process
GO:0000122	0.970	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0032991	0.962	protein-containing complex
GO:0140513	0.856	nuclear protein-containing complex
GO:0005667	0.838	transcription regulator complex
GO:0090575	0.804	RNA polymerase II transcription regulator complex
GO:0005654	0.574	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]