StarFunc result for job id Q14934

User Input

>input (902 residues)
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPAV
SFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14934	1.000	1.000	0.000	902	1.000	1.000	Q14934.pdb.gz	NFAC4_HUMAN Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2
2	AFDB:A0A0G2JTY4	0.381	0.323	4.345E-58	1076	0.436	0.365	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
3	AFDB:B5B2S1	0.278	0.240	4.682E-57	1075	0.446	0.374	B5B2S1.pdb.gz	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
4	AFDB:A0A1D5PNG2	0.248	0.251	2.807E-49	890	0.358	0.363	A0A1D5PNG2.pdb.gz
5	AFDB:A1Z8J4	0.067	0.043	1.674E-5	1557	0.180	0.104	A1Z8J4.pdb.gz	A1Z8J4_DROME No mechanoreceptor potential A, isoform A OS=Drosophila melanogaster OX=7227 GN=nompA PE=4 SV=1
6	AFDB:Q54NE5	0.079	0.048	2.692E-5	1918	0.098	0.046	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
7	PDB:5c6wJ	0.083	0.244	3.963E-5	238	0.031	0.118	5c6wJ.pdb.gz
8	PDB:6vxkB	0.095	0.113	1.081E-4	747	0.049	0.059	6vxkB.pdb.gz
9	AFDB:Q15735	0.095	0.087	1.539E-4	1006	0.169	0.151	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
10	AFDB:Q6P1E1	0.063	0.056	1.901E-4	1072	0.176	0.148	Q6P1E1.pdb.gz	ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zmiz1 PE=1 SV=1
11	PDB:1l9mB	0.108	0.129	3.279E-4	681	0.048	0.063	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
12	PDB:7czpH	0.096	0.286	7.242E-4	222	0.029	0.117	7czpH.pdb.gz
13	PDB:4pygA	0.118	0.142	7.635E-4	685	0.031	0.041	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
14	PDB:7tvzE	0.113	0.140	7.635E-4	665	0.051	0.069	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
15	PDB:4v96AA	0.070	0.173	1.686E-3	299	0.034	0.104	4v96AA.pdb.gz
16	PDB:2qhrL	0.093	0.235	1.976E-3	218	0.038	0.156	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	PDB:1ngwH	0.085	0.233	2.083E-3	216	0.037	0.153	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
18	AFDB:F4IS91	0.042	0.031	2.277E-3	1340	0.146	0.099	F4IS91.pdb.gz	RSA1_ARATH Protein SHORT ROOT IN SALT MEDIUM 1 OS=Arabidopsis thaliana OX=3702 GN=RSA1 PE=1 SV=1
19	PDB:6kzbC	0.121	0.152	2.713E-3	649	0.032	0.045	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	AFDB:E7FB74	0.058	0.064	6.905E-3	765	0.132	0.156	E7FB74.pdb.gz	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTY4	0.0	557	1076	0.400	0.336	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
2	A0A8I6AB55	0.0	557	1052	0.395	0.338	A0A8I6AB55_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
3	D3Z9H7	0.0	1372	901	0.926	0.927	NFAC4_RAT Nuclear factor of activated T-cells, cytoplasmic 4 OS=Rattus norvegicus OX=10116 GN=Nfatc4 PE=1 SV=1
4	D3ZU59	0.0	556	1068	0.395	0.333	D3ZU59_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
5	P97305	0.0	554	1075	0.398	0.334	NFAC3_MOUSE Nuclear factor of activated T-cells, cytoplasmic 3 OS=Mus musculus OX=10090 GN=Nfatc3 PE=1 SV=1
6	Q14934	0.0	1769	902	1.000	1.000	NFAC4_HUMAN Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2
7	Q8K120	0.0	1365	901	0.924	0.925	NFAC4_MOUSE Nuclear factor of activated T-cells, cytoplasmic 4 OS=Mus musculus OX=10090 GN=Nfatc4 PE=1 SV=2
8	I3L3K7	2.40e-180	550	1047	0.397	0.342	I3L3K7_HUMAN Nuclear factor of activated T cells 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
9	B5B2S0	4.35e-180	550	1068	0.392	0.331	B5B2S0_HUMAN Nuclear factor of activated T-cells c3 isoform IB-Xa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
10	B5B2S1	7.85e-180	550	1075	0.396	0.332	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
11	Q12968	7.85e-180	550	1075	0.396	0.332	NFAC3_HUMAN Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
12	H3BR83	3.87e-175	537	1053	0.366	0.313	H3BR83_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
13	H3BRS1	4.28e-175	537	1060	0.366	0.311	H3BRS1_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
14	Q19AW4	6.05e-136	429	867	0.283	0.294	Q19AW4_DANRE Nuclear factor of activated T-cells calcineurin-dependent 1 OS=Danio rerio OX=7955 GN=si:ch211-198c22.2 PE=2 SV=1
15	A0A1D5PI24	3.86e-134	420	732	0.273	0.336	A0A1D5PI24_CHICK Nuclear factor of activated T cells 1 OS=Gallus gallus OX=9031 GN=NFATC1 PE=4 SV=2
16	A0A0G2JXL2	8.93e-133	422	925	0.282	0.275	A0A0G2JXL2_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=2
17	D3ZE20	1.72e-132	422	939	0.282	0.271	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
18	O88942	4.10e-132	414	717	0.273	0.343	NFAC1_MOUSE Nuclear factor of activated T-cells, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Nfatc1 PE=1 SV=1
19	O95644	1.22e-127	409	943	0.282	0.269	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
20	W5U9R6	1.06e-125	402	879	0.265	0.272	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02594 DUF167	7e+02	11.7	Uncharacterised ACR, YggU family COG1872
2	PF16179 RHD_dimer	2.6e-17	74.1	Rel homology dimerisation domain
3	PF00554 RHD_DNA_bind	1.4e-17	75.7	Rel homology DNA-binding domain
4	PF01833 TIG	0.0045	28.4	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362008.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010382888.1	0.929	Transcription factor GATA-4
2	61622.XP_010371396.1	0.890	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
3	61622.XP_010354720.1	0.886	Myocyte-specific enhancer factor 2D isoform X1
4	61622.XP_010368010.1	0.861	Serum response factor isoform X1
5	61622.XP_010363201.1	0.856	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
6	61622.XP_010384995.1	0.848	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 45 ESTs, 7 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
7	61622.XP_010353353.1	0.843	Nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
8	61622.XP_010378937.1	0.831	Protein phosphatase 3 regulatory subunit B, alpha
9	61622.XP_010361672.1	0.829	Nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
10	61622.XP_010363672.1	0.823	Protein phosphatase 3 catalytic subunit gamma
11	61622.XP_010387523.1	0.702	SRY-box 10
12	61622.XP_010372459.1	0.675	Protein phosphatase 3 regulatory subunit B, beta
13	61622.XP_010382904.1	0.659	Transcription factor GATA-4-like
14	61622.XP_010379694.1	0.655	Protein phosphatase 3 catalytic subunit alpha
15	61622.XP_010378029.1	0.610	GTPase IMAP family member 7
16	61622.XP_010364756.1	0.609	Belongs to the peptidase C1 family.
17	61622.XP_010381990.1	0.595	Estrogen receptor beta isoform X1
18	61622.XP_010375595.1	0.594	Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proin [...]
19	61622.XP_010384993.1	0.567	Transmembrane protein 161A
20	61622.XP_010362015.1	0.547	Adenylate cyclase type 4 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.917	transcription cis-regulatory region binding
GO:0000977	0.808	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.720	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.613	enzyme binding
GO:0001216	0.612	DNA-binding transcription activator activity
GO:0001228	0.589	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.981	response to stimulus
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0051252	0.949	regulation of RNA metabolic process
GO:0048519	0.943	negative regulation of biological process
GO:0010468	0.929	regulation of gene expression
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0009987	0.917	cellular process
GO:0048518	0.894	positive regulation of biological process
GO:0048523	0.893	negative regulation of cellular process
GO:0048522	0.872	positive regulation of cellular process
GO:0006950	0.850	response to stress
GO:0010604	0.824	positive regulation of macromolecule metabolic process
GO:0051173	0.786	positive regulation of nitrogen compound metabolic process
GO:0031325	0.784	positive regulation of cellular metabolic process
GO:0051716	0.763	cellular response to stimulus
GO:0010605	0.703	negative regulation of macromolecule metabolic process
GO:0051172	0.632	negative regulation of nitrogen compound metabolic process
GO:0031324	0.631	negative regulation of cellular metabolic process
GO:0032502	0.586	developmental process
GO:0045935	0.557	positive regulation of nucleobase-containing compound metabolic process
GO:0032501	0.548	multicellular organismal process
GO:0048856	0.548	anatomical structure development
GO:0010557	0.535	positive regulation of macromolecule biosynthetic process
GO:0051254	0.535	positive regulation of RNA metabolic process
GO:0031328	0.533	positive regulation of cellular biosynthetic process
GO:1902680	0.519	positive regulation of RNA biosynthetic process
GO:0023052	0.517	signaling
GO:0007154	0.517	cell communication
GO:1903508	0.509	positive regulation of nucleic acid-templated transcription
GO:0007165	0.486	signal transduction
GO:0008152	0.485	metabolic process
GO:0071704	0.483	organic substance metabolic process
GO:0044237	0.473	cellular metabolic process
GO:0006357	0.469	regulation of transcription by RNA polymerase II
GO:0045893	0.467	positive regulation of DNA-templated transcription
GO:0045934	0.426	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.424	negative regulation of RNA metabolic process
GO:0009890	0.411	negative regulation of biosynthetic process
GO:0042221	0.397	response to chemical
GO:0045892	0.396	negative regulation of DNA-templated transcription
GO:0044238	0.392	primary metabolic process
GO:0007275	0.386	multicellular organism development
GO:0045944	0.383	positive regulation of transcription by RNA polymerase II
GO:0048583	0.375	regulation of response to stimulus
GO:0006807	0.363	nitrogen compound metabolic process
GO:0010646	0.336	regulation of cell communication
GO:0023051	0.332	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005654	0.988	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]