StarFunc result for job id Q14938

User Input

>input (502 residues)
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL
LGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLA
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASG
PNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGR
SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPG
SPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQPN
GSGQGKVPGSFLLPPPPPVARPVPLPMPDSKSTSTAPDGAALTPPSPSFATTGASSANRF
VSIGPRDGNFLNIPQQSQSWFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14938	0.999	0.999	8.282E-73	502	1.000	1.000	Q14938.pdb.gz	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
2	AFDB:C9JWJ8	0.459	0.565	4.379E-52	403	0.737	0.918	C9JWJ8.pdb.gz	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
3	AFDB:A0A0R4IU09	0.491	0.566	3.214E-49	432	0.671	0.780	A0A0R4IU09.pdb.gz
4	AFDB:B1AKN8	0.461	0.436	9.058E-49	532	0.709	0.669	B1AKN8.pdb.gz	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
5	AFDB:B1AKN5	0.438	0.451	2.970E-47	487	0.701	0.723	B1AKN5.pdb.gz	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
6	AFDB:B1AKN7	0.454	0.487	2.180E-44	466	0.681	0.734	B1AKN7.pdb.gz	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
7	AFDB:P97863	0.455	0.403	7.191E-39	570	0.606	0.533	P97863.pdb.gz	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
8	AFDB:A0A286YEX4	0.425	0.403	9.445E-39	530	0.580	0.549	A0A286YEX4.pdb.gz	A0A286YEX4_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=1
9	AFDB:Q5VW27	0.448	0.462	1.679E-36	487	0.538	0.554	Q5VW27.pdb.gz	Q5VW27_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
10	AFDB:B8A4T4	0.369	0.896	2.259E-29	204	0.355	0.873	B8A4T4.pdb.gz
11	PDB:1rp3A	0.080	0.137	5.794	235	0.020	0.043	1rp3A.pdb.gz
12	PDB:1l0oC	0.063	0.458	7.610	57	0.024	0.211	1l0oC.pdb.gz	Crystal structure of the Bacillus stearothermophilus anti-sigma factor SpoIIAB with the sporulation sigma factor sigmaF.
13	PDB:2v4jC	0.065	0.260	7.610	103	0.014	0.068	2v4jC.pdb.gz	The Crystal Structure of Desulfovibrio Vulgaris Dissimilatory Sulfite Reductase Bound to Dsrc Provides Novel Insights Into the Mechanism of Sulfate Respiration.
14	PDB:7p9uB	0.064	0.070	7.610	455	0.026	0.029	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UK09	0.0	609	508	0.701	0.693	A0A590UK09_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
2	A0A8J8YK50	0.0	526	503	0.610	0.608	A0A8J8YK50_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
3	B1AKN5	0.0	601	487	0.683	0.704	B1AKN5_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
4	B1AKN7	0.0	588	466	0.667	0.719	B1AKN7_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
5	B1AKN8	0.0	601	532	0.691	0.652	B1AKN8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=1
6	C9JWJ8	0.0	882	460	0.906	0.989	C9JWJ8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=3
7	P09414	0.0	620	509	0.709	0.699	NFIA_RAT Nuclear factor 1 A-type OS=Rattus norvegicus OX=10116 GN=Nfia PE=1 SV=2
8	P70257	0.0	998	488	0.964	0.992	NFIX_MOUSE Nuclear factor 1 X-type OS=Mus musculus OX=10090 GN=Nfix PE=1 SV=2
9	Q02780	0.0	600	532	0.691	0.652	NFIA_MOUSE Nuclear factor 1 A-type OS=Mus musculus OX=10090 GN=Nfia PE=1 SV=1
10	Q12857	0.0	619	509	0.707	0.697	NFIA_HUMAN Nuclear factor 1 A-type OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=2
11	Q14938	0.0	1035	502	1.000	1.000	NFIX_HUMAN Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX PE=1 SV=2
12	Q5VW26	0.0	522	570	0.604	0.532	Q5VW26_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
13	S4R3W2	0.0	569	511	0.663	0.652	S4R3W2_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIA PE=1 SV=2
14	A0A8I6AFY4	6.49e-180	518	570	0.600	0.528	A0A8I6AFY4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
15	P97863	7.80e-180	518	570	0.600	0.528	NFIB_MOUSE Nuclear factor 1 B-type OS=Mus musculus OX=10090 GN=Nfib PE=1 SV=2
16	O70186	4.06e-179	513	494	0.604	0.613	O70186_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
17	F7F711	1.36e-176	507	491	0.594	0.607	F7F711_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=1
18	Q5VW30	1.67e-176	509	561	0.598	0.535	Q5VW30_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1
19	O70185	3.16e-175	506	561	0.594	0.531	O70185_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfib PE=1 SV=2
20	A0A2R8Y7V8	1.60e-174	504	566	0.588	0.521	A0A2R8Y7V8_HUMAN Nuclear factor 1 OS=Homo sapiens OX=9606 GN=NFIB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00859 CTF_NFI	2e-128	439.8	CTF/NF-I family transcription modulation region
2	PF03165 MH1	1.1e-07	43.4	MH1 domain
3	PF10524 NfI_DNAbd_pre-N	3e-23	92.7	Nuclear factor I protein pre-N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008853670.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008848010.1	0.719	Presenilin-1
2	1026970.XP_008850162.1	0.679	Zinc finger protein AEBP2 isoform X1
3	1026970.XP_008839028.1	0.674	Nicastrin
4	1026970.XP_008826261.1	0.652	Gamma-secretase subunit PEN-2
5	1026970.XP_008835147.1	0.638	Ran-binding protein 3 isoform X1
6	1026970.XP_008854005.1	0.627	Lysine demethylase 6B
7	1026970.XP_008854016.1	0.617	FMR1 autosomal homolog 2
8	1026970.XP_008819832.1	0.603	Neurofibromin isoform X1
9	1026970.XP_008831621.1	0.598	Programmed cell death 6-interacting protein isoform X1
10	1026970.XP_008821817.1	0.589	Muscleblind-like protein 2 isoform X1
11	1026970.XP_008838563.1	0.585	POU domain, class 2, transcription factor 1 isoform X1
12	1026970.XP_008834833.1	0.578	Ecdysoneless cell cycle regulator
13	1026970.XP_008841637.1	0.557	E74 like ETS transcription factor 2
14	1026970.XP_008845399.1	0.545	Amyloid beta A4 protein
15	1026970.XP_008825136.1	0.538	High mobility group nucleosome binding domain 1
16	1026970.XP_008849090.1	0.525	SRY-box 9
17	1026970.XP_008827573.1	0.524	DNA-directed RNA polymerase III subunit RPC7
18	1026970.XP_008849361.1	0.524	Brain-derived neurotrophic factor isoform X1
19	1026970.XP_008820583.1	0.517	Presenilin 2
20	1026970.XP_008823846.1	0.517	Transcriptional repressor protein YY1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.937	transcription cis-regulatory region binding
GO:0000987	0.934	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.483	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0031327	0.989	negative regulation of cellular biosynthetic process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0051252	0.983	regulation of RNA metabolic process
GO:0045934	0.976	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.974	regulation of DNA-templated transcription
GO:1903507	0.967	negative regulation of nucleic acid-templated transcription
GO:0048518	0.962	positive regulation of biological process
GO:0048522	0.947	positive regulation of cellular process
GO:0009987	0.942	cellular process
GO:0045892	0.899	negative regulation of DNA-templated transcription
GO:0031325	0.897	positive regulation of cellular metabolic process
GO:0051173	0.896	positive regulation of nitrogen compound metabolic process
GO:0010604	0.889	positive regulation of macromolecule metabolic process
GO:0010557	0.867	positive regulation of macromolecule biosynthetic process
GO:0031328	0.864	positive regulation of cellular biosynthetic process
GO:0071704	0.795	organic substance metabolic process
GO:0032502	0.770	developmental process
GO:0043170	0.762	macromolecule metabolic process
GO:0006357	0.761	regulation of transcription by RNA polymerase II
GO:0045935	0.758	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.747	positive regulation of DNA-templated transcription
GO:0048856	0.725	anatomical structure development
GO:0044238	0.699	primary metabolic process
GO:0044237	0.697	cellular metabolic process
GO:0006807	0.663	nitrogen compound metabolic process
GO:0048513	0.532	animal organ development
GO:0010467	0.502	gene expression
GO:0048869	0.473	cellular developmental process
GO:0030154	0.451	cell differentiation
GO:0034641	0.437	cellular nitrogen compound metabolic process
GO:0009888	0.322	tissue development
GO:0032501	0.310	multicellular organismal process
GO:0045944	0.305	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.739	cytoplasm
GO:0043232	0.498	intracellular non-membrane-bounded organelle
GO:0032991	0.475	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]