StarFunc result for job id Q14953

User Input

>input (304 residues)
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLL
HREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRT
FQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQE
VSYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14952	0.755	0.755	3.540E-53	304	0.938	0.938	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
2	AFDB:P43626	0.733	0.645	1.129E-49	348	0.898	0.784	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
3	AFDB:P43632	0.726	0.726	1.633E-48	304	0.878	0.878	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
4	AFDB:P43629	0.688	0.482	4.807E-43	444	0.753	0.516	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	AFDB:P43630	0.636	0.430	8.291E-43	455	0.816	0.545	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	AFDB:Q8N743	0.636	0.474	7.453E-39	410	0.664	0.493	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.612	0.497	1.787E-34	377	0.609	0.491	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:O75022	0.625	0.321	6.911E-29	631	0.398	0.192	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8N423	0.643	0.340	1.012E-28	598	0.395	0.201	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
10	AFDB:P59901	0.637	0.396	4.176E-28	499	0.332	0.202	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
11	PDB:5c6wJ	0.250	0.299	2.967E-7	238	0.102	0.130	5c6wJ.pdb.gz
12	PDB:1knoE	0.254	0.340	4.529E-6	214	0.102	0.145	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.
13	PDB:1f11A	0.247	0.325	6.282E-6	216	0.089	0.125	1f11A.pdb.gz
14	PDB:1ngwH	0.270	0.338	6.282E-6	216	0.092	0.130	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
15	PDB:1frgL	0.246	0.318	9.200E-6	217	0.089	0.124	1frgL.pdb.gz	Crystal structure of a peptide complex of anti-influenza peptide antibody Fab 26/9. Comparison of two different antibodies bound to the same peptide antigen.
16	PDB:1pskL	0.266	0.356	9.200E-6	213	0.099	0.141	1pskL.pdb.gz
17	PDB:3bn9F	0.280	0.347	9.200E-6	224	0.092	0.125	3bn9F.pdb.gz
18	PDB:1fdlL	0.265	0.350	1.083E-5	214	0.086	0.121	1fdlL.pdb.gz
19	PDB:1uwxL	0.248	0.328	1.276E-5	211	0.095	0.137	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
20	PDB:1ahwA	0.228	0.304	1.503E-5	214	0.109	0.154	1ahwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	545	348	0.895	0.782	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	527	348	0.878	0.767	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	543	341	0.898	0.801	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43631	0.0	577	304	0.918	0.918	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
5	P43632	0.0	548	304	0.878	0.878	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	Q14952	0.0	585	304	0.938	0.938	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	Q14953	0.0	632	304	1.000	1.000	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
8	Q14954	0.0	580	304	0.921	0.921	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
9	F2VZG2	7.62e-177	492	293	0.806	0.836	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
10	P43629	5.32e-158	450	444	0.753	0.516	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
11	P43630	2.73e-154	441	455	0.753	0.503	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
12	Q14943	1.30e-150	429	382	0.701	0.558	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
13	Q8N743	2.09e-138	399	410	0.668	0.495	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	Q99706	4.57e-120	351	377	0.609	0.491	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	O75022	2.00e-44	161	631	0.332	0.160	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
16	Q8N423	1.43e-43	159	597	0.329	0.168	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
17	Q8NHL6	9.05e-43	157	650	0.326	0.152	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
18	Q8N6C8	7.81e-41	149	439	0.276	0.191	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
19	P59901	8.16e-41	150	499	0.299	0.182	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
20	Q8N149	8.41e-41	149	483	0.293	0.184	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	1.2e-18	78.4	Immunoglobulin domain
2	PF13895 Ig_2	0.00011	33.8	Immunoglobulin domain
3	PF13927 Ig_3	2.6e-05	36.0	Immunoglobulin domain
4	PF16680 Ig_4	40	16.2	T-cell surface glycoprotein CD3 delta chain
5	PF07686 V-set	2.4e+02	13.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342215

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000379873	0.983	HLA class I histocompatibility antigen, A-3 alpha chain
3	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
4	9606.ENSP00000438038	0.971	NKG2-A/NKG2-B type II integral membrane protein
5	9606.ENSP00000391592	0.962	Tyrosine-protein phosphatase non-receptor type 6
6	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
7	9606.ENSP00000399168	0.957	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000452780	0.953	Beta-2-microglobulin
9	9606.ENSP00000325525	0.921	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000340944	0.914	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000336769	0.904	Killer cell immunoglobulin-like receptor 2DL1
12	9606.ENSP00000375608	0.891	Killer cell immunoglobulin-like receptor 3DL1
13	9606.ENSP00000262629	0.885	TYRO protein tyrosine kinase-binding protein
14	9606.ENSP00000365817	0.884	HLA class I histocompatibility antigen, alpha chain E
15	9606.ENSP00000310216	0.870	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.837	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.825	annotation not available
19	9606.ENSP00000240618	0.822	Killer cell lectin-like receptor subfamily K, member 1
20	9606.ENSP00000291860	0.809	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.530	signaling receptor activity
GO:0004888	0.493	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0006952	0.953	defense response
GO:0002682	0.950	regulation of immune system process
GO:0048583	0.944	regulation of response to stimulus
GO:0002376	0.936	immune system process
GO:0007165	0.925	signal transduction
GO:0050776	0.823	regulation of immune response
GO:0048518	0.753	positive regulation of biological process
GO:0002764	0.495	immune response-regulating signaling pathway
GO:0002684	0.489	positive regulation of immune system process
GO:0007166	0.478	cell surface receptor signaling pathway
GO:0048584	0.461	positive regulation of response to stimulus
GO:0006955	0.450	immune response
GO:0045088	0.412	regulation of innate immune response
GO:0050778	0.401	positive regulation of immune response
GO:0006968	0.360	cellular defense response
GO:0002768	0.336	immune response-regulating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]