StarFunc result for job id Q14956

User Input

>input (572 residues)
MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYP
VWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNC
RNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL
GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFV
TMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHTVN
HTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLE
LSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSI
PTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTS
TLISVPDRDPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKG
LSVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14956	1.000	1.000	0.000	572	1.000	1.000	Q14956.pdb.gz	GPNMB_HUMAN Transmembrane glycoprotein NMB OS=Homo sapiens OX=9606 GN=GPNMB PE=1 SV=2
2	AFDB:Q6P7C7	0.796	0.796	1.157E-85	572	0.691	0.691	Q6P7C7.pdb.gz	GPNMB_RAT Transmembrane glycoprotein NMB OS=Rattus norvegicus OX=10116 GN=Gpnmb PE=2 SV=1
3	AFDB:Q99P91	0.799	0.796	2.726E-84	574	0.696	0.693	Q99P91.pdb.gz	GPNMB_MOUSE Transmembrane glycoprotein NMB OS=Mus musculus OX=10090 GN=Gpnmb PE=1 SV=2
4	AFDB:P40967	0.545	0.477	6.244E-45	661	0.301	0.260	P40967.pdb.gz	PMEL_HUMAN Melanocyte protein PMEL OS=Homo sapiens OX=9606 GN=PMEL PE=1 SV=2
5	AFDB:B8A520	0.543	0.508	1.238E-44	616	0.290	0.269	B8A520.pdb.gz
6	AFDB:Q60696	0.528	0.486	3.195E-44	626	0.308	0.281	Q60696.pdb.gz	PMEL_MOUSE Melanocyte protein PMEL OS=Mus musculus OX=10090 GN=Pmel PE=1 SV=2
7	AFDB:F1R9D2	0.599	0.426	1.256E-43	825	0.323	0.224	F1R9D2.pdb.gz
8	AFDB:Q98917	0.530	0.409	4.279E-42	763	0.302	0.227	Q98917.pdb.gz	PMEL_CHICK Melanocyte protein PMEL OS=Gallus gallus OX=9031 GN=PMEL PE=1 SV=3
9	AFDB:B3DJD9	0.601	0.421	1.227E-41	845	0.325	0.220	B3DJD9.pdb.gz
10	AFDB:Q8N3G9	0.340	0.432	8.148E-23	435	0.164	0.216	Q8N3G9.pdb.gz	TM130_HUMAN Transmembrane protein 130 OS=Homo sapiens OX=9606 GN=TMEM130 PE=1 SV=1
11	PDB:7q1yA	0.177	0.097	4.197E-8	1374	0.070	0.029	7q1yA.pdb.gz
12	PDB:7u05B	0.173	0.135	9.889E-7	815	0.070	0.049	7u05B.pdb.gz
13	PDB:6h03A	0.201	0.113	1.588E-6	1223	0.072	0.034	6h03A.pdb.gz
14	PDB:7sqcO0	0.119	0.074	2.690E-6	1140	0.084	0.042	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:4lnvB	0.133	0.086	4.099E-6	1063	0.080	0.043	4lnvB.pdb.gz
16	PDB:6dldD	0.112	0.201	5.622E-6	269	0.058	0.123	6dldD.pdb.gz
17	PDB:4ziqA	0.141	0.074	1.990E-5	1450	0.087	0.034	4ziqA.pdb.gz
18	PDB:5a42A	0.169	0.079	2.729E-5	1597	0.075	0.027	5a42A.pdb.gz
19	PDB:7nycA	0.174	0.085	2.876E-5	1542	0.087	0.032	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4lnvA	0.261	0.136	3.032E-5	1276	0.075	0.034	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14956	0.0	1189	572	1.000	1.000	GPNMB_HUMAN Transmembrane glycoprotein NMB OS=Homo sapiens OX=9606 GN=GPNMB PE=1 SV=2
2	Q6P7C7	0.0	810	572	0.687	0.687	GPNMB_RAT Transmembrane glycoprotein NMB OS=Rattus norvegicus OX=10116 GN=Gpnmb PE=2 SV=1
3	Q99P91	0.0	800	574	0.678	0.676	GPNMB_MOUSE Transmembrane glycoprotein NMB OS=Mus musculus OX=10090 GN=Gpnmb PE=1 SV=2
4	Q1ECY0	1.47e-51	191	825	0.173	0.120	Q1ECY0_DANRE Melanocyte protein PMEL precursor OS=Danio rerio OX=7955 GN=silva PE=2 SV=1
5	Q98917	2.98e-51	190	763	0.185	0.139	PMEL_CHICK Melanocyte protein PMEL OS=Gallus gallus OX=9031 GN=PMEL PE=1 SV=3
6	Q60696	1.99e-48	180	626	0.191	0.174	PMEL_MOUSE Melanocyte protein PMEL OS=Mus musculus OX=10090 GN=Pmel PE=1 SV=2
7	Q1JQ71	2.96e-46	174	616	0.171	0.159	Q1JQ71_DANRE Melanocyte protein Pmel 17 precursor OS=Danio rerio OX=7955 GN=silvb PE=2 SV=1
8	P40967	3.04e-45	171	661	0.178	0.154	PMEL_HUMAN Melanocyte protein PMEL OS=Homo sapiens OX=9606 GN=PMEL PE=1 SV=2
9	G3V0E7	1.13e-04	47.0	339	0.040	0.068	G3V0E7_HUMAN Transmembrane protein 130 OS=Homo sapiens OX=9606 GN=TMEM130 PE=1 SV=1
10	Q8N3G9	1.60e-04	46.6	435	0.040	0.053	TM130_HUMAN Transmembrane protein 130 OS=Homo sapiens OX=9606 GN=TMEM130 PE=1 SV=1
11	A0A8I6AC84	0.010	41.6	4254	0.044	0.006	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
12	F1MAD3	0.010	41.6	4292	0.044	0.006	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
13	Q9ERV0	0.011	41.6	4283	0.044	0.006	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
14	P98161	0.28	37.0	4303	0.042	0.006	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
15	O08852	0.50	35.8	4293	0.038	0.005	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
16	Q7Z5L2	1.3	34.3	792	0.044	0.032	R3HCL_HUMAN Coiled-coil domain-containing protein R3HCC1L OS=Homo sapiens OX=9606 GN=R3HCC1L PE=1 SV=3
17	Q9Y6V0	2.2	33.9	5142	0.030	0.003	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
18	Q9QYX7	3.6	33.1	5068	0.028	0.003	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
19	F4JJP1	4.0	33.1	1221	0.028	0.013	Y4759_ARATH WEB family protein At4g27595, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At4g27595 PE=2 SV=1
20	Q38A75	6.8	32.0	418	0.028	0.038	Q38A75_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1440 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20433 PKAT_KLD	8.4e-22	88.5	PKAT, KLD domain
2	PF00801 PKD	7.6e-05	33.8	PKD domain
3	PF18911 PKD_4	4.9e-07	41.1	PKD domain
4	PF15706 TMEM132D_C	40	15.4	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371420

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.994	Epidermal growth factor receptor
2	9606.ENSP00000361818	0.982	Syndecan-4
3	9606.ENSP00000437955	0.919	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000233143	0.829	Thymosin beta-10
5	9606.ENSP00000442460	0.829	Protein-tyrosine kinase 6
6	9606.ENSP00000247461	0.828	Calnexin
7	9606.ENSP00000321106	0.825	Protachykinin-1
8	9606.ENSP00000298910	0.771	Leucine-rich repeat serine/threonine-protein kinase 2
9	9606.ENSP00000296511	0.740	Annexin A5
10	9606.ENSP00000398632	0.736	CD44 antigen
11	9606.ENSP00000373570	0.728	5,6-dihydroxyindole-2-carboxylic acid oxidase
12	9606.ENSP00000230990	0.700	Proheparin-binding EGF-like growth factor
13	9606.ENSP00000371253	0.650	Trifunctional purine biosynthetic protein adenosine-3
14	9606.ENSP00000347665	0.648	Collagen alpha-1(XVIII) chain
15	9606.ENSP00000392762	0.648	L-dopachrome tautomerase
16	9606.ENSP00000357709	0.629	Protein S100-A6
17	9606.ENSP00000254301	0.618	Galectin-3
18	9606.ENSP00000416330	0.579	Transforming growth factor-beta-induced protein ig-h3
19	9606.ENSP00000253079	0.569	Coiled-coil domain-containing protein 62
20	9606.ENSP00000346839	0.556	Fibronectin type III domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0008201	1.000	heparin binding
GO:0043394	0.996	proteoglycan binding
GO:0030546	0.996	signaling receptor activator activity
GO:0048018	0.994	receptor ligand activity
GO:0045545	0.840	syndecan binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0048519	0.954	negative regulation of biological process
GO:0048583	0.935	regulation of response to stimulus
GO:0019222	0.935	regulation of metabolic process
GO:0031323	0.922	regulation of cellular metabolic process
GO:0009893	0.919	positive regulation of metabolic process
GO:0023051	0.915	regulation of signaling
GO:0051174	0.914	regulation of phosphorus metabolic process
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0010646	0.910	regulation of cell communication
GO:0043408	0.904	regulation of MAPK cascade
GO:0010604	0.900	positive regulation of macromolecule metabolic process
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0080090	0.895	regulation of primary metabolic process
GO:0051239	0.890	regulation of multicellular organismal process
GO:0019220	0.886	regulation of phosphate metabolic process
GO:0010562	0.883	positive regulation of phosphorus metabolic process
GO:0031401	0.871	positive regulation of protein modification process
GO:0050896	0.868	response to stimulus
GO:0042325	0.866	regulation of phosphorylation
GO:0048584	0.856	positive regulation of response to stimulus
GO:0001932	0.847	regulation of protein phosphorylation
GO:0023056	0.846	positive regulation of signaling
GO:0010647	0.846	positive regulation of cell communication
GO:0045937	0.838	positive regulation of phosphate metabolic process
GO:0010468	0.834	regulation of gene expression
GO:0010605	0.830	negative regulation of macromolecule metabolic process
GO:1902533	0.821	positive regulation of intracellular signal transduction
GO:0042127	0.808	regulation of cell population proliferation
GO:0042327	0.807	positive regulation of phosphorylation
GO:0043410	0.773	positive regulation of MAPK cascade
GO:0030155	0.767	regulation of cell adhesion
GO:0070372	0.767	regulation of ERK1 and ERK2 cascade
GO:0050865	0.761	regulation of cell activation
GO:0048523	0.734	negative regulation of cellular process
GO:0070374	0.728	positive regulation of ERK1 and ERK2 cascade
GO:0002682	0.678	regulation of immune system process
GO:0001934	0.667	positive regulation of protein phosphorylation
GO:0001818	0.654	negative regulation of cytokine production
GO:0034103	0.600	regulation of tissue remodeling
GO:0023052	0.587	signaling
GO:0051716	0.571	cellular response to stimulus
GO:0007154	0.564	cell communication
GO:0070663	0.548	regulation of leukocyte proliferation
GO:0007162	0.545	negative regulation of cell adhesion
GO:0002694	0.512	regulation of leukocyte activation
GO:0070664	0.495	negative regulation of leukocyte proliferation
GO:0007165	0.453	signal transduction
GO:0032944	0.448	regulation of mononuclear cell proliferation
GO:0050866	0.440	negative regulation of cell activation
GO:0051726	0.436	regulation of cell cycle
GO:0032501	0.433	multicellular organismal process
GO:0002695	0.427	negative regulation of leukocyte activation
GO:0051249	0.421	regulation of lymphocyte activation
GO:0040012	0.380	regulation of locomotion
GO:0032502	0.374	developmental process
GO:0008152	0.365	metabolic process
GO:0048856	0.358	anatomical structure development
GO:0071704	0.356	organic substance metabolic process
GO:1901987	0.348	regulation of cell cycle phase transition
GO:0071840	0.347	cellular component organization or biogenesis
GO:0010941	0.344	regulation of cell death
GO:0016043	0.316	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005737	0.952	cytoplasm
GO:0012505	0.951	endomembrane system
GO:0031982	0.872	vesicle
GO:0097708	0.487	intracellular vesicle
GO:0031410	0.462	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]