StarFunc result for job id Q14957

User Input

>input (1233 residues)
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPL
EIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASHVSWRLLDVVTLELGPGGPRARTQRLLRQLDAPVFVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPATFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYWRQHGTLPAPAGDCRVHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVQPTMVV
IALNRHRLWEMVGRWEHGVLYMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDVAPYTKLCCKGFCIDILKKLARVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKSGGPAFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFSGVQSLASPPRQASPDLTASSAQASVLKMLQAA
RDMVTTAGVSSSLDRATRTIENWGGGRRAPPPSPCPTPRSGPSPCLPTPDPPPEPSPTGW
GPPDGGRAALVRRAPQPPGRPPTPGPPLSDVSRVSRRPAWEARWPVRTGHCGRHLSASER
PLSPARCHYSSFPRADRSGRPFLPLFPELEDLPLLGPEQLARREALLHAAWARGSRPRHA
SLPSSVAEAFARPSSLPAGCTGPACARPDGHSACRRLAQAQSMCLPIYREACQEGEQAGA
PAWQHRQHVCLHAHAHLPFCWGAVCPHLPPCASHGSWLSGAWGPLGHRGRTLGLGTGYRD
SGGLDEISRVARGTQGFPGPCTWRRISSLESEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7XY94	0.649	0.555	0.000	1448	0.444	0.378	A7XY94.pdb.gz	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
2	AFDB:B7ZSK1	0.658	0.562	0.000	1451	0.440	0.374	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
3	AFDB:O15399	0.664	0.614	0.000	1336	0.509	0.470	O15399.pdb.gz	NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens OX=9606 GN=GRIN2D PE=1 SV=2
4	AFDB:P35436	0.664	0.563	0.000	1464	0.450	0.379	P35436.pdb.gz	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
5	AFDB:Q14957	1.000	1.000	0.000	1233	1.000	1.000	Q14957.pdb.gz	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
6	AFDB:Q61984	0.596	0.610	0.000	1203	0.674	0.691	Q61984.pdb.gz	Q61984_MOUSE Glutamate receptor OS=Mus musculus OX=10090 GN=NMDA2C PE=3 SV=1
7	PDB:4tllA	0.248	0.383	5.243E-50	767	0.152	0.244	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
8	PDB:4pe5C	0.247	0.388	1.542E-48	754	0.162	0.265	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
9	PDB:7rz4A	0.240	0.289	3.541E-48	993	0.152	0.188	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
10	PDB:7ocaA	0.231	0.343	5.517E-48	775	0.165	0.263	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
11	PDB:7rzaA	0.239	0.289	1.230E-46	981	0.152	0.191	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
12	PDB:4tlmC	0.252	0.397	2.453E-45	750	0.157	0.257	4tlmC.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
13	PDB:5iouA	0.242	0.356	9.806E-45	803	0.170	0.260	5iouA.pdb.gz	Mechanism of NMDA Receptor Inhibition and Activation.
14	PDB:5idfB	0.227	0.360	1.096E-44	734	0.142	0.238	5idfB.pdb.gz
15	PDB:5kbtA	0.242	0.298	1.006E-43	973	0.161	0.203	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
16	PDB:5weoA	0.237	0.286	1.256E-43	988	0.159	0.198	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
17	AFDB:A0A0B4LHR4	0.241	0.243	1.175E-13	1224	0.127	0.128	A0A0B4LHR4.pdb.gz	A0A0B4LHR4_DROME Metabotropic GABA-B receptor subtype 2, isoform C OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
18	AFDB:H0ZRP5	0.225	0.223	2.416E-13	1243	0.127	0.126	H0ZRP5.pdb.gz	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
19	AFDB:A0A2R8QRD5	0.093	0.105	9.728E-4	1065	0.092	0.107	A0A2R8QRD5.pdb.gz
20	AFDB:Q6NYC8	0.039	0.072	2.706E-2	613	0.065	0.131	Q6NYC8.pdb.gz	PPR18_HUMAN Phostensin OS=Homo sapiens OX=9606 GN=PPP1R18 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7XY94	0.0	1041	1448	0.421	0.358	NMDE2_XENLA Glutamate receptor ionotropic, NMDA 2B OS=Xenopus laevis OX=8355 GN=grin2b PE=1 SV=1
2	B7ZSK1	0.0	1054	1451	0.410	0.348	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
3	G1TPJ8	0.0	992	888	0.407	0.565	G1TPJ8_RABIT Glutamate receptor OS=Oryctolagus cuniculus OX=9986 GN=GRIN2D PE=3 SV=2
4	O15399	0.0	1070	1336	0.447	0.412	NMDE4_HUMAN Glutamate receptor ionotropic, NMDA 2D OS=Homo sapiens OX=9606 GN=GRIN2D PE=1 SV=2
5	P35436	0.0	1054	1464	0.414	0.348	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
6	Q00959	0.0	1051	1464	0.412	0.347	NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2
7	Q00960	0.0	1040	1482	0.403	0.335	NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus OX=10116 GN=Grin2b PE=1 SV=1
8	Q00961	0.0	2125	1237	0.885	0.882	NMDE3_RAT Glutamate receptor ionotropic, NMDA 2C OS=Rattus norvegicus OX=10116 GN=Grin2c PE=1 SV=1
9	Q01097	0.0	1038	1482	0.402	0.335	NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3
10	Q01098	0.0	2150	1239	0.890	0.885	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
11	Q03391	0.0	1073	1323	0.448	0.417	NMDE4_MOUSE Glutamate receptor ionotropic, NMDA 2D OS=Mus musculus OX=10090 GN=Grin2d PE=1 SV=3
12	Q12879	0.0	1047	1464	0.414	0.348	NMDE1_HUMAN Glutamate receptor ionotropic, NMDA 2A OS=Homo sapiens OX=9606 GN=GRIN2A PE=1 SV=1
13	Q13224	0.0	1042	1484	0.404	0.336	NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens OX=9606 GN=GRIN2B PE=1 SV=3
14	Q14957	0.0	2523	1233	1.000	1.000	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
15	Q61984	0.0	1548	1203	0.611	0.626	Q61984_MOUSE Glutamate receptor OS=Mus musculus OX=10090 GN=NMDA2C PE=3 SV=1
16	Q62645	0.0	1072	1323	0.447	0.416	NMDE4_RAT Glutamate receptor ionotropic, NMDA 2D OS=Rattus norvegicus OX=10116 GN=Grin2d PE=1 SV=2
17	Q9W581	2.55e-132	434	1083	0.206	0.235	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
18	X2JDW0	2.94e-132	434	1082	0.206	0.235	X2JDW0_DROME NMDA receptor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
19	Q6IWN7	3.24e-132	434	1070	0.206	0.237	Q6IWN7_DROME NMDA receptor 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
20	E1JJC6	1.45e-131	428	941	0.204	0.268	E1JJC6_DROME NMDA receptor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	2.3e-10	51.8	Receptor family ligand binding region
2	PF00060 Lig_chan	5.6e-32	122.1	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	7.7e-25	98.7	Ligated ion channel L-glutamate- and glycine-binding site
4	PF10565 NMDAR2_C	2.1e-07	41.9	N-methyl D-aspartate receptor 2B3 C-terminus
5	PF00497 SBP_bac_3	9.1e-21	85.9	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.984	Disks large homolog 4
2	9606.ENSP00000360608	0.967	Glutamate receptor ionotropic, NMDA 1
3	9606.ENSP00000384620	0.941	Pro-neuregulin-1, membrane-bound isoform
4	9606.ENSP00000296526	0.940	Glutamate receptor 2
5	9606.ENSP00000355155	0.935	Glutamate receptor ionotropic, NMDA 3A
6	9606.ENSP00000342235	0.931	Receptor tyrosine-protein kinase erbB-4
7	9606.ENSP00000379818	0.927	Glutamate receptor ionotropic, NMDA 2A
8	9606.ENSP00000362680	0.919	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000477455	0.914	Glutamate receptor ionotropic, NMDA 2B
10	9606.ENSP00000263269	0.908	Glutamate receptor ionotropic, NMDA 2D
11	9606.ENSP00000363480	0.880	Disks large homolog 3
12	9606.ENSP00000477999	0.857	Nitric oxide synthase, brain
13	9606.ENSP00000300105	0.845	Voltage-dependent calcium channel gamma-2 subunit
14	9606.ENSP00000365272	0.844	Disks large homolog 2
15	9606.ENSP00000428994	0.842	Glutamate receptor 1
16	9606.ENSP00000440185	0.841	Proenkephalin-B
17	9606.ENSP00000005284	0.838	Voltage-dependent calcium channel gamma-3 subunit
18	9606.ENSP00000282499	0.823	Glutamate receptor 4
19	9606.ENSP00000263314	0.817	P2X purinoceptor 3
20	9606.ENSP00000481554	0.817	Glutamate receptor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005261	1.000	monoatomic cation channel activity
GO:0004972	1.000	NMDA glutamate receptor activity
GO:1901702	0.995	salt transmembrane transporter activity
GO:0046873	0.995	metal ion transmembrane transporter activity
GO:0005262	0.966	calcium channel activity
GO:0099094	0.951	ligand-gated monoatomic cation channel activity
GO:0099604	0.933	ligand-gated calcium channel activity
GO:0022849	0.572	glutamate-gated calcium ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050896	0.992	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0023052	0.989	signaling
GO:0007154	0.989	cell communication
GO:0051716	0.983	cellular response to stimulus
GO:0032501	0.975	multicellular organismal process
GO:0007165	0.974	signal transduction
GO:0007215	0.964	glutamate receptor signaling pathway
GO:0065008	0.934	regulation of biological quality
GO:0051179	0.915	localization
GO:0042391	0.910	regulation of membrane potential
GO:0048583	0.811	regulation of response to stimulus
GO:0006811	0.801	monoatomic ion transport
GO:0051239	0.711	regulation of multicellular organismal process
GO:0010646	0.704	regulation of cell communication
GO:0023051	0.693	regulation of signaling
GO:0006816	0.684	calcium ion transport
GO:0050804	0.605	modulation of chemical synaptic transmission
GO:0048518	0.371	positive regulation of biological process
GO:0099536	0.357	synaptic signaling
GO:0098660	0.356	inorganic ion transmembrane transport
GO:0007268	0.352	chemical synaptic transmission
GO:0098662	0.311	inorganic cation transmembrane transport
GO:0034220	0.311	monoatomic ion transmembrane transport
GO:0031644	0.305	regulation of nervous system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.997	endomembrane system
GO:0005737	0.997	cytoplasm
GO:0008328	0.997	ionotropic glutamate receptor complex
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0031090	0.995	organelle membrane
GO:0031984	0.985	organelle subcompartment
GO:0017146	0.985	NMDA selective glutamate receptor complex
GO:0005789	0.982	endoplasmic reticulum membrane
GO:0030054	0.672	cell junction
GO:0045202	0.570	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.968	Ca(2+)(in) = Ca(2+)(out)

[back to server]