StarFunc result for job id Q14966

User Input

>input (1978 residues)
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARGIPHRFAGHES
YQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPHGSRWDDEPHISASVAVKQSS
VTQVTEQSPKVQSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRRLPNLPSQSRNKETLGSEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVEN
EFQSQQNISASVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSS
NVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHADAQKMKRLPTPSMMNDYYAAS
PRIFPHLCSLCNVECSHLKDWIQHQNTSTHIESCRQLRQQYPDWNPEILPSRRNEGNRKE
NETPRRRSHSPSPRRSRRSSSSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSR
SPYRIRNPFRGSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLSECKQVSDKAV
SLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPFGKVNDVLIVPYRKEAYLEME
FKEAITAIMKYIETTPLTIKGKSVKICVPGKKKAQNKEVKKKTLESKKVSASTLKRDADA
SKAVEIVTSTSAAKTGQAKASVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKK
SLEAKKTGNVKNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINRKAAESMVKFY
TCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPEANIDTIYDRFVHLDNLPEDG
LQCVLCVGLQFGKVDHHVFISNRNKAILQLDSPESAQSMYSFLKQNPQNIGDHMLTCSLS
PKIDLPEVQIEHDPELEKESPGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETL
VQQEEPCEEEAEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECAL
NQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDFISGITQTMVE
AVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNISEKKGNMDEKEEKEFNTKET
RMDLQIGTEKAEKNEGRMDAEKVEKMAAMKEKPAENTLFKAYPNKGVGQANKPDETSKTS
ILAVSDVSSSKPSIKAVIVSSPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLL
KPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIM
KRDDSNNKTLAEQNTKNPKSTTGRSSKSKEEPLFPFNLDEFVTVDEVIEEVNPSQAKQNP
LKGKRKETLKNVPFSELNLKKKKGKTSTPRGVEGELSFVTLDEIGEEEDAAAHLAQALVT
VDEVIDEEELNMEEMVKNSNSLFTLDELIDQDDCISHSEPKDVTVLSVAEEQDLLKQERL
VTVDEIGEVEELPLNESADITFATLNTKGNEGDTVRDSIGFISSQVPEDPSTLVTVDEIQ
DDSSDLHLVTLDEVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKND
HPTDKKGNRKKRAVDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAKTPTKRVRIGK
TLPSEKAVVTEPAKGEEAFQMSEVDEESGLKDSEPERKRKKTEDSSSGKSVASDVPEELD
FLVPKAGFFCPICSLFYSGEKAMTNHCKSTRHKQNTEKFMAKQRKEKEQNEAEERSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14966	1.000	1.000	0.000	1978	1.000	1.000	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
2	PDB:5vsuA	0.085	0.326	3.887E-8	387	0.024	0.124	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
3	AFDB:Q8I3A0	0.046	0.037	2.270E-7	2568	0.091	0.070	Q8I3A0.pdb.gz	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
4	PDB:7evoD	0.037	0.334	4.959E-7	200	0.017	0.170	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
5	AFDB:Q9W244	0.044	0.044	1.720E-6	1995	0.113	0.112	Q9W244.pdb.gz	Q9W244_DROME Plexus, isoform A OS=Drosophila melanogaster OX=7227 GN=px PE=4 SV=2
6	PDB:6y5qq	0.038	0.362	2.656E-6	178	0.015	0.163	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
7	PDB:7oqcF	0.037	0.256	5.634E-6	267	0.012	0.086	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
8	AFDB:Q8IY92	0.040	0.042	9.211E-6	1834	0.132	0.142	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
9	AFDB:F1QSH8	0.046	0.052	1.381E-5	1553	0.106	0.135	F1QSH8.pdb.gz
10	AFDB:Q9VUQ9	0.048	0.046	2.610E-5	2139	0.130	0.121	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	PDB:5lsbA	0.038	0.356	3.589E-5	176	0.015	0.165	5lsbA.pdb.gz
12	PDB:6y53o	0.045	0.388	4.270E-5	160	0.012	0.144	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	AFDB:O43151	0.037	0.039	4.932E-5	1795	0.118	0.130	O43151.pdb.gz	TET3_HUMAN Methylcytosine dioxygenase TET3 OS=Homo sapiens OX=9606 GN=TET3 PE=1 SV=4
14	AFDB:Q9VU86	0.036	0.038	1.245E-4	1873	0.121	0.128	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
15	AFDB:A0A1D5NS76	0.039	0.039	1.481E-4	2005	0.118	0.117	A0A1D5NS76.pdb.gz
16	PDB:6ff7X	0.037	0.379	1.525E-4	171	0.015	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	AFDB:P35820	0.044	0.050	1.867E-4	1601	0.105	0.130	P35820.pdb.gz	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
18	PDB:7r5jF0	0.037	0.281	5.141E-4	241	0.012	0.100	7r5jF0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:6r5kH	0.041	0.166	6.115E-4	394	0.015	0.076	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
20	PDB:3lqvB	0.038	0.549	9.169E-4	115	0.011	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14966	0.0	4065	1978	1.000	1.000	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
2	P43244	1.10e-09	66.2	845	0.012	0.028	MATR3_RAT Matrin-3 OS=Rattus norvegicus OX=10116 GN=Matr3 PE=1 SV=2
3	P43243	1.12e-09	66.2	847	0.012	0.028	MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2
4	Q8K310	1.18e-09	66.2	846	0.012	0.028	MATR3_MOUSE Matrin-3 OS=Mus musculus OX=10090 GN=Matr3 PE=1 SV=1
5	E9PT37	6.43e-09	63.9	1207	0.015	0.024	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
6	Q3UQS8	6.81e-09	63.9	1199	0.015	0.024	RBM20_MOUSE RNA-binding protein 20 OS=Mus musculus OX=10090 GN=Rbm20 PE=1 SV=3
7	P0DW16	4.89e-08	60.8	1223	0.015	0.024	RBM20_PIG RNA-binding protein 20 OS=Sus scrofa OX=9823 GN=RBM20 PE=1 SV=1
8	Q5T481	8.19e-08	60.1	1227	0.014	0.023	RBM20_HUMAN RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=4
9	Q80XZ1	1.84e-04	48.9	588	0.016	0.053	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
10	Q9BTG3	3.83e-04	48.1	837	0.011	0.025	Q9BTG3_HUMAN CIZ1 protein OS=Homo sapiens OX=9606 PE=1 SV=1
11	F5H2X7	3.93e-04	48.1	954	0.011	0.022	F5H2X7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
12	H0Y5D5	3.94e-04	48.1	820	0.011	0.026	H0Y5D5_HUMAN CDKN1A interacting zinc finger protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
13	Q9ULV3	4.00e-04	48.1	898	0.011	0.023	CIZ1_HUMAN Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2
14	Q5SYW2	4.07e-04	48.1	870	0.011	0.024	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
15	A0A494C0L7	4.51e-04	47.8	820	0.011	0.026	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
16	A2AN61	5.39e-04	47.4	821	0.011	0.026	A2AN61_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
17	Q8VEH2	5.86e-04	47.4	845	0.011	0.025	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
18	Q3TXU6	6.44e-04	47.4	800	0.011	0.026	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
19	Q3UUV0	6.87e-04	47.4	791	0.011	0.027	Q3UUV0_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
20	Q3TMV1	7.00e-04	47.0	796	0.011	0.026	Q3TMV1_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	7.7e-05	33.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF13893 RRM_5	1.2	20.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF12171 zf-C2H2_jaz	0.23	23.0	Zinc-finger double-stranded RNA-binding
4	PF12874 zf-met	7.4e+02	12.0	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.918	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000282516	0.853	Nipped-B-like protein
3	9606.ENSP00000402527	0.835	Sentrin-specific protease 6
4	9606.ENSP00000307208	0.834	Nucleosome-remodeling factor subunit BPTF
5	9606.ENSP00000386665	0.767	Four and a half LIM domains protein 2
6	9606.ENSP00000418563	0.703	U2 snRNP-associated SURP motif-containing protein
7	9606.ENSP00000335321	0.695	Splicing factor 3B subunit 1
8	9606.ENSP00000368017	0.677	Zinc finger C3H1 domain-containing protein
9	9606.ENSP00000340494	0.601	Zinc finger protein 395
10	9606.ENSP00000430236	0.588	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
11	9606.ENSP00000417509	0.584	Protein TASOR
12	9606.ENSP00000339245	0.564	YTH domain-containing protein 1
13	9606.ENSP00000304769	0.537	Zinc finger protein 467
14	9606.ENSP00000417291	0.537	Replication initiator 1
15	9606.ENSP00000355388	0.534	M-phase phosphoprotein 8
16	9606.ENSP00000354346	0.528	Matrin-3
17	9606.ENSP00000381053	0.528	Zinc finger MYND domain-containing protein 11
18	9606.ENSP00000425092	0.503	Luc7-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003690	0.999	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0016070	0.945	RNA metabolic process
GO:0006396	0.924	RNA processing
GO:0008380	0.873	RNA splicing
GO:0050789	0.716	regulation of biological process
GO:0050794	0.703	regulation of cellular process
GO:0019222	0.671	regulation of metabolic process
GO:0060255	0.651	regulation of macromolecule metabolic process
GO:0080090	0.594	regulation of primary metabolic process
GO:0051171	0.594	regulation of nitrogen compound metabolic process
GO:0031323	0.583	regulation of cellular metabolic process
GO:0010468	0.550	regulation of gene expression
GO:0019219	0.420	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.413	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]