StarFunc result for job id Q14978

User Input

>input (699 residues)
MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKS
AKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAA
AKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPP
KNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPK
KTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPP
KKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAE
SSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEE
EEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPR
PQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQA
KKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQ
VLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14978	0.999	0.999	3.213E-74	699	1.000	1.000	Q14978.pdb.gz	NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2
2	AFDB:P41777	0.215	0.214	1.974E-48	704	0.741	0.736	P41777.pdb.gz	NOLC1_RAT Nucleolar and coiled-body phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Nolc1 PE=1 SV=2
3	AFDB:E9Q5C9	0.178	0.177	7.182E-45	702	0.725	0.722	E9Q5C9.pdb.gz	NOLC1_MOUSE Nucleolar and coiled-body phosphoprotein 1 OS=Mus musculus OX=10090 GN=Nolc1 PE=1 SV=1
4	AFDB:B8JIY2	0.135	0.100	7.990E-14	1001	0.443	0.310	B8JIY2.pdb.gz	B8JIY2_DANRE Nucleolar and coiled-body phosphoprotein 1 OS=Danio rerio OX=7955 GN=fd05f01 PE=1 SV=1
5	AFDB:Q9XVS4	0.098	0.074	8.241E-5	971	0.316	0.228	Q9XVS4.pdb.gz	NOLC1_CAEEL Nucleolar protein dao-5 OS=Caenorhabditis elegans OX=6239 GN=dao-5 PE=1 SV=1
6	AFDB:M9PFZ1	0.078	0.071	1.002E-3	773	0.259	0.234	M9PFZ1.pdb.gz	M9PFZ1_DROME Nopp140, isoform E OS=Drosophila melanogaster OX=7227 GN=Nopp140 PE=1 SV=1
7	AFDB:Q38DX4	0.069	0.098	1.575E-2	495	0.152	0.214	Q38DX4.pdb.gz	Q38DX4_TRYB2 LisH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1800 PE=4 SV=1
8	AFDB:Q7Z2C9	0.077	0.075	6.445E-2	720	0.236	0.229	Q7Z2C9.pdb.gz	Q7Z2C9_DROME Nopp140-like nucleolar protein OS=Drosophila melanogaster OX=7227 GN=Nopp140 PE=2 SV=1
9	AFDB:Q9NRM1	0.047	0.033	6.895E-1	1142	0.142	0.087	Q9NRM1.pdb.gz	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
10	PDB:6q8fA	0.055	0.181	7.217E-1	197	0.017	0.061	6q8fA.pdb.gz
11	AFDB:A2QET8	0.053	0.057	1.080	624	0.149	0.167	A2QET8.pdb.gz	A2QET8_ASPNC Contig An02c0390, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An02g12210 PE=3 SV=1
12	PDB:4evyA	0.037	0.125	5.976	147	0.017	0.082	4evyA.pdb.gz	Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
13	PDB:5gadi	0.036	0.050	8.232	450	0.017	0.027	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
14	PDB:2l3yA	0.044	0.127	8.777	184	0.014	0.054	2l3yA.pdb.gz
15	PDB:2mphA	0.045	0.102	8.777	224	0.027	0.085	2mphA.pdb.gz
16	PDB:6gciA	0.035	0.065	8.777	292	0.017	0.041	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
17	PDB:2pfjB	0.034	0.112	9.976	130	0.013	0.069	2pfjB.pdb.gz	The structural basis of Holliday junction resolution by T7 endonuclease I.
18	PDB:6igmH	0.033	0.056	9.976	373	0.020	0.038	6igmH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRM9	0.0	1310	708	0.997	0.984	A0A0A0MRM9_HUMAN Nucleolar and coiled-body phosphoprotein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=1
2	Q14978	0.0	1324	699	1.000	1.000	NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2
3	Q96J17	0.0	793	418	0.598	1.000	Q96J17_HUMAN NOLC1 protein OS=Homo sapiens OX=9606 GN=NOLC1 PE=2 SV=1
4	P41777	9.25e-101	326	704	0.482	0.479	NOLC1_RAT Nucleolar and coiled-body phosphoprotein 1 OS=Rattus norvegicus OX=10116 GN=Nolc1 PE=1 SV=2
5	E9Q5C9	8.88e-70	243	702	0.185	0.184	NOLC1_MOUSE Nucleolar and coiled-body phosphoprotein 1 OS=Mus musculus OX=10090 GN=Nolc1 PE=1 SV=1
6	B8JIY2	2.44e-43	170	1001	0.109	0.076	B8JIY2_DANRE Nucleolar and coiled-body phosphoprotein 1 OS=Danio rerio OX=7955 GN=fd05f01 PE=1 SV=1
7	M9MSM4	3.26e-30	129	685	0.082	0.083	M9MSM4_DROME Nopp140, isoform F OS=Drosophila melanogaster OX=7227 GN=Nopp140 PE=1 SV=1
8	Q7KTV5	3.36e-30	129	686	0.082	0.083	Q7KTV5_DROME Nopp140, isoform B OS=Drosophila melanogaster OX=7227 GN=Nopp140 PE=1 SV=1
9	Q9LU74	4.41e-12	70.1	330	0.052	0.109	Q9LU74_ARATH AT5g57120/MUL3_6 OS=Arabidopsis thaliana OX=3702 GN=MUL3.6 PE=1 SV=1
10	Q9XVS4	1.55e-09	63.9	971	0.057	0.041	NOLC1_CAEEL Nucleolar protein dao-5 OS=Caenorhabditis elegans OX=6239 GN=dao-5 PE=1 SV=1
11	M9PEI1	5.40e-05	49.3	21657	0.139	0.004	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC41	5.54e-05	49.3	22743	0.139	0.004	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PB32	5.97e-05	49.3	19560	0.139	0.005	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PBZ0	6.24e-05	49.3	22830	0.139	0.004	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PB30	6.29e-05	49.3	22949	0.139	0.004	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
16	M9PC45	6.67e-05	48.9	22300	0.139	0.004	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PEH5	6.84e-05	48.9	20710	0.139	0.005	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	A0A0R4IBK5	7.82e-05	48.9	5209	0.117	0.016	R213A_DANRE E3 ubiquitin-protein ligase rnf213-alpha OS=Danio rerio OX=7955 GN=rnf213a PE=3 SV=1
19	M9PBZ4	8.88e-05	48.5	18014	0.139	0.005	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PB31	1.04e-04	48.5	20404	0.139	0.005	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05022 SRP40_C	2.7e-24	97.1	SRP40, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221801	0.997	rRNA 2'-O-methyltransferase fibrillarin
2	9606.ENSP00000264279	0.997	Nucleolar protein 58
3	9606.ENSP00000358563	0.997	H/ACA ribonucleoprotein complex subunit 4
4	9606.ENSP00000370589	0.997	Nucleolar protein 56
5	9606.ENSP00000263857	0.983	DNA-directed RNA polymerase I subunit RPA1
6	9606.ENSP00000240316	0.979	Coilin
7	9606.ENSP00000274606	0.964	H/ACA ribonucleoprotein complex subunit 2
8	9606.ENSP00000322396	0.960	Ribosome biogenesis regulatory protein homolog
9	9606.ENSP00000460871	0.960	Ribosomal L1 domain-containing protein 1
10	9606.ENSP00000258772	0.949	Probable ATP-dependent RNA helicase DDX56
11	9606.ENSP00000444136	0.949	DNA-directed RNA polymerase I subunit RPA2
12	9606.ENSP00000297990	0.944	Nucleolar protein 6
13	9606.ENSP00000262506	0.933	Casein kinase II subunit alpha
14	9606.ENSP00000455106	0.926	Ribosome biogenesis protein BOP1
15	9606.ENSP00000232888	0.923	U3 small nucleolar RNA-interacting protein 2
16	9606.ENSP00000317992	0.923	Nucleolar complex protein 2 homolog
17	9606.ENSP00000338862	0.921	Ribosome biogenesis protein BRX1 homolog
18	9606.ENSP00000383949	0.919	NHP2-like protein 1
19	9606.ENSP00000371858	0.911	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
20	9606.ENSP00000384302	0.910	WD repeat-containing protein 43

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140678	1.000	molecular function inhibitor activity
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0046982	1.000	protein heterodimerization activity
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:1901360	0.976	organic cyclic compound metabolic process
GO:0071840	0.958	cellular component organization or biogenesis
GO:0006139	0.956	nucleobase-containing compound metabolic process
GO:0090304	0.935	nucleic acid metabolic process
GO:0016070	0.928	RNA metabolic process
GO:0034660	0.914	ncRNA metabolic process
GO:0019222	0.895	regulation of metabolic process
GO:0010467	0.883	gene expression
GO:0051171	0.882	regulation of nitrogen compound metabolic process
GO:0080090	0.877	regulation of primary metabolic process
GO:0031323	0.876	regulation of cellular metabolic process
GO:0060255	0.875	regulation of macromolecule metabolic process
GO:0044085	0.853	cellular component biogenesis
GO:0010468	0.777	regulation of gene expression
GO:0006396	0.753	RNA processing
GO:0031326	0.726	regulation of cellular biosynthetic process
GO:0010556	0.723	regulation of macromolecule biosynthetic process
GO:0022613	0.622	ribonucleoprotein complex biogenesis
GO:0032501	0.493	multicellular organismal process
GO:0032502	0.474	developmental process
GO:0016043	0.471	cellular component organization
GO:0048518	0.428	positive regulation of biological process
GO:0048522	0.399	positive regulation of cellular process
GO:0048856	0.355	anatomical structure development
GO:0034470	0.341	ncRNA processing
GO:0042254	0.317	ribosome biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001650	0.998	fibrillar center
GO:0005654	0.971	nucleoplasm
GO:0005737	0.930	cytoplasm
GO:0032991	0.533	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]