StarFunc result for job id Q14980

User Input

>input (2115 residues)
MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSER
LDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFE
YKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIR
FLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAEN
RKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ
DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQA
QLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQ
EAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQ
AKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQ
QQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD
AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVE
TARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEE
EKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQA
ETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKE
ECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD
DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQF
CSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADL
ALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKEL
EELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQ
EQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ
DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESE
KSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAE
RAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKR
HREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSML
KKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS
TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLAD
SDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTH
YDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQV
RSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSK
LPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDS
GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARL
GSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRI
AELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTG
ITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTK
QADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA
AAIGATPRAKGKAKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q7G0	0.180	0.181	0.000	2094	0.815	0.823	E9Q7G0.pdb.gz	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
2	AFDB:Q14980	1.000	1.000	0.000	2115	1.000	1.000	Q14980.pdb.gz	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
3	AFDB:Q8IR55	0.065	0.057	1.211E-14	2567	0.187	0.154	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
4	AFDB:Q9P219	0.055	0.058	3.883E-13	2028	0.191	0.199	Q9P219.pdb.gz	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
5	AFDB:P85120	0.068	0.069	6.863E-13	2058	0.166	0.171	P85120.pdb.gz	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
6	AFDB:A0A2R8QCI3	0.060	0.062	6.693E-12	2023	0.187	0.196	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
7	AFDB:Q5SNZ0	0.068	0.076	1.532E-11	1873	0.179	0.202	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
8	AFDB:Q6VGS5	0.059	0.062	5.306E-11	2009	0.187	0.197	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
9	AFDB:Q0DY81	0.068	0.119	3.793E-10	1155	0.092	0.169	Q0DY81.pdb.gz	NMCPA_ORYSJ Nuclear matrix constituent protein 1a OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1A PE=2 SV=1
10	AFDB:A0A166B1A6	0.073	0.128	6.044E-10	1119	0.092	0.174	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
11	PDB:7sx8D	0.046	0.195	3.448E-2	448	0.010	0.049	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
12	PDB:6z6oC	0.064	0.222	2.734E-1	548	0.012	0.047	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
13	PDB:7n6g3I	0.062	0.189	3.541E-1	401	0.031	0.165	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7ungC4	0.052	0.362	5.643E-1	219	0.009	0.087	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:7vvuV	0.047	0.634	5.643E-1	113	0.010	0.186	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
16	PDB:7ajuUL	0.031	0.061	5.942E-1	779	0.012	0.033	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:3k29A	0.065	0.746	6.258E-1	162	0.010	0.136	3k29A.pdb.gz
18	PDB:5nugA	0.049	0.036	8.991E-1	2920	0.009	0.007	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
19	PDB:7d5sRN	0.033	0.097	9.469E-1	607	0.022	0.076	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:6pojA	0.031	0.106	1.165	292	0.012	0.086	6pojA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AMK5	0.0	3156	2092	0.811	0.820	A0A8I6AMK5_RAT Nuclear mitotic apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Numa1 PE=1 SV=1
2	E9Q7G0	0.0	3234	2094	0.820	0.829	NUMA1_MOUSE Nuclear mitotic apparatus protein 1 OS=Mus musculus OX=10090 GN=Numa1 PE=1 SV=1
3	F1LW91	0.0	3189	2106	0.817	0.821	F1LW91_RAT Nuclear mitotic apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Numa1 PE=1 SV=3
4	F5H4J1	0.0	1677	851	0.402	1.000	F5H4J1_HUMAN Nuclear mitotic apparatus protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=8
5	F5H6Y5	0.0	1370	691	0.327	1.000	F5H6Y5_HUMAN Nuclear mitotic apparatus protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=1
6	F7FF45	0.0	3129	2086	0.806	0.817	F7FF45_RAT Nuclear mitotic apparatus protein 1 OS=Rattus norvegicus OX=10116 GN=Numa1 PE=1 SV=3
7	H0YFY6	0.0	1872	964	0.447	0.980	H0YFY6_HUMAN Nuclear mitotic apparatus protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=1
8	Q14980	0.0	4179	2115	1.000	1.000	NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2
9	Q4G051	0.0	1131	638	0.270	0.895	Q4G051_RAT Numa1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Numa1 PE=2 SV=1
10	Q910C5	2.69e-07	58.9	1931	0.118	0.129	Q910C5_CHICK Chick atrial myosin heavy chain OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q10411	0.002	45.8	1957	0.059	0.063	SPO15_SCHPO Sporulation-specific protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo15 PE=1 SV=1
12	P12883	0.004	45.1	1935	0.114	0.125	MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=1 SV=5
13	Q508P8	0.005	44.7	1938	0.108	0.118	Q508P8_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=im:6897999 PE=1 SV=1
14	Q91Z83	0.005	44.7	1935	0.113	0.124	MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 PE=2 SV=1
15	I3LSP4	0.007	43.9	1005	0.055	0.116	I3LSP4_PIG Golgin subfamily A member 2 OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=2
16	P32380	0.007	43.9	944	0.052	0.115	SP110_YEAST Spindle pole body component 110 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC110 PE=1 SV=1
17	F1RRA0	0.011	43.5	872	0.055	0.134	F1RRA0_PIG Golgin subfamily A conserved domain-containing protein OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=4
18	P02564	0.013	43.1	1935	0.113	0.124	MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7 PE=1 SV=2
19	Q8CGU1	0.014	42.7	691	0.044	0.136	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
20	P13533	0.024	42.4	1939	0.116	0.126	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311579	0.963	Tankyrase-1
2	9606.ENSP00000300403	0.962	Targeting protein for Xklp2
3	9606.ENSP00000345259	0.953	Protein 4.1
4	9606.ENSP00000290158	0.951	Importin subunit beta-1
5	9606.ENSP00000216911	0.939	Aurora kinase A
6	9606.ENSP00000446215	0.934	GTP-binding nuclear protein Ran
7	9606.ENSP00000438483	0.927	Importin subunit alpha-1
8	9606.ENSP00000324020	0.923	Kinesin-like protein KIF15
9	9606.ENSP00000256442	0.922	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000311032	0.922	Caspase-3
11	9606.ENSP00000392828	0.918	G-protein-signaling modulator 1
12	9606.ENSP00000265164	0.917	Caspase-6
13	9606.ENSP00000369871	0.908	HAUS augmin-like complex subunit 6
14	9606.ENSP00000247843	0.907	YEATS domain-containing protein 4
15	9606.ENSP00000229758	0.894	F-box only protein 5
16	9606.ENSP00000377060	0.891	Chromobox protein homolog 1
17	9606.ENSP00000385510	0.881	G-protein-signaling modulator 2
18	9606.ENSP00000296930	0.773	Nucleophosmin
19	9606.ENSP00000251413	0.771	Tubulin gamma-1 chain
20	9606.ENSP00000378699	0.763	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0044877	0.830	protein-containing complex binding
GO:0019904	0.780	protein domain specific binding
GO:0051010	0.765	microtubule plus-end binding
GO:0070840	0.762	dynein complex binding
GO:0035091	0.759	phosphatidylinositol binding
GO:0051011	0.647	microtubule minus-end binding
GO:0097718	0.642	disordered domain specific binding
GO:0005198	0.514	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.975	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0007049	0.939	cell cycle
GO:0071840	0.881	cellular component organization or biogenesis
GO:0016043	0.874	cellular component organization
GO:0048518	0.829	positive regulation of biological process
GO:0051179	0.813	localization
GO:0006996	0.789	organelle organization
GO:0022402	0.775	cell cycle process
GO:0007010	0.773	cytoskeleton organization
GO:0048522	0.766	positive regulation of cellular process
GO:0000226	0.762	microtubule cytoskeleton organization
GO:0000278	0.714	mitotic cell cycle
GO:1903047	0.632	mitotic cell cycle process
GO:0051641	0.577	cellular localization
GO:0007051	0.499	spindle organization
GO:0051726	0.497	regulation of cell cycle
GO:0010564	0.437	regulation of cell cycle process
GO:0051128	0.428	regulation of cellular component organization
GO:0033043	0.419	regulation of organelle organization
GO:0044085	0.407	cellular component biogenesis
GO:0022607	0.379	cellular component assembly
GO:0007059	0.318	chromosome segregation
GO:0051649	0.313	establishment of localization in cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0005654	0.995	nucleoplasm
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005856	0.953	cytoskeleton
GO:0005819	0.928	spindle
GO:0000922	0.878	spindle pole
GO:0099080	0.840	supramolecular complex
GO:0016363	0.738	nuclear matrix
GO:0099512	0.676	supramolecular fiber
GO:0005876	0.656	spindle microtubule
GO:0005886	0.425	plasma membrane
GO:0097431	0.394	mitotic spindle pole
GO:0070062	0.393	extracellular exosome
GO:0099738	0.387	cell cortex region
GO:0051233	0.385	spindle midzone
GO:0005881	0.385	cytoplasmic microtubule
GO:0031616	0.384	spindle pole centrosome
GO:0035371	0.384	microtubule plus-end
GO:0036449	0.383	microtubule minus-end
GO:0019897	0.381	extrinsic component of plasma membrane
GO:1905720	0.380	cytoplasmic microtubule bundle
GO:1990023	0.380	mitotic spindle midzone
GO:0055028	0.380	cortical microtubule
GO:0061673	0.380	mitotic spindle astral microtubule
GO:0032991	0.343	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]