StarFunc result for job id Q14993

User Input

>input (1142 residues)
MRLTGPWKLWLWMSIFLLPASTSVTVRDKTEESCPILRIEGHQLTYDNINKLEVSGFDLG
DSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKKERWFLW
QVLNQQNIPQISIVVDGGKKVVEFMFQATEGDVLNYIFRNRELRPLFDRQWHKLGISIQS
QVISLYMDCNLIARRQTDEKDTVDFHGRTVIATRASDGKPVDIELHQLKIYCSANLIAQE
TCCEISDTKCPEQDGFGNIASSWVTAHASKMSSYLPAKQELKDQCQCIPNKGEAGLPGAP
GSPGQKGHKGEPGENGLHGAPGFPGQKGEQGFEGSKGETGEKGEQGEKGDPALAGLNGEN
GLKGDLGPHGPPGPKGEKGDTGPPGPPALPGSLGIQGPQGPPGKEGQRGRRGKTGPPGKP
GPPGPPGPPGIQGIHQTLGGYYNKDNKGNDEHEAGGLKGDKGETGLPGFPGSVGPKGQKG
EPGEPFTKGEKGDRGEPGVIGSQGVKGEPGDPGPPGLIGSPGLKGQQGSAGSMGPRGPPG
DVGLPGEHGIPGKQGIKGEKGDPGGIIGPPGLPGPKGEAGPPGKSLPGEPGLDGNPGAPG
PRGPKGERGLPGVHGSPGDIGPQGIGIPGRTGAQGPAGEPGIQGPRGLPGLPGTPGTPGN
DGVPGRDGKPGLPGPPGDPIALPLLGDIGALLKNFCGNCQASVPGLKSNKGEEGGAGEPG
KYDSMARKGDIGPRGPPGIPGREGPKGSKGERGYPGIPGEKGDEGLQGIPGIPGAPGPTG
PPGLMGRTGHPGPTGAKGEKGSDGPPGKPGPPGPPGIPFNERNGMSSLYKIKGGVNVPSY
PGPPGPPGPKGDPGPVGEPGAMGLPGLEGFPGVKGDRGPAGPPGIAGMSGKPGAPGPPGV
PGEPGERGPVGDIGFPGPEGPSGKPGINGKDGIPGAQGIMGKPGDRGPKGERGDQGIPGD
RGSQGERGKPGLTGMKGAIGPMGPPGNKGSMGSPGHQGPPGSPGIPGIPADAVSFEEIKK
YINQEVLRIFEERMAVFLSQLKLPAAMLAAQAYGRPGPPGKDGLPGPPGDPGPQGYRGQK
GERGEPGIGLPGSPGLPGTSALGLPGSPGAPGPQGPPGPSGRCNPEDCLYPVSHAHQRTG
GN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0VF58	0.265	0.266	0.000	1136	0.830	0.835	Q0VF58.pdb.gz	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
2	AFDB:Q14993	1.000	1.000	0.000	1142	1.000	1.000	Q14993.pdb.gz	COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens OX=9606 GN=COL19A1 PE=1 SV=3
3	AFDB:Q8NFW1	0.192	0.136	3.159E-38	1626	0.468	0.328	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
4	AFDB:Q8BLX7	0.199	0.148	3.025E-35	1580	0.434	0.314	Q8BLX7.pdb.gz	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
5	AFDB:Q07092	0.191	0.137	9.359E-34	1604	0.461	0.328	Q07092.pdb.gz	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
6	AFDB:E9Q7P1	0.185	0.132	3.051E-33	1613	0.467	0.330	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
7	AFDB:A0A0R4IR54	0.183	0.131	2.066E-32	1622	0.417	0.293	A0A0R4IR54.pdb.gz
8	AFDB:G3MXK9	0.192	0.176	2.749E-31	1257	0.331	0.301	G3MXK9.pdb.gz	G3MXK9_BOVIN Collagen type XVI alpha 1 chain OS=Bos taurus OX=9913 GN=COL16A1 PE=4 SV=2
9	AFDB:P20849	0.176	0.216	6.200E-25	921	0.324	0.402	P20849.pdb.gz	CO9A1_HUMAN Collagen alpha-1(IX) chain OS=Homo sapiens OX=9606 GN=COL9A1 PE=1 SV=3
10	AFDB:O35206	0.153	0.130	8.462E-18	1367	0.278	0.232	O35206.pdb.gz	COFA1_MOUSE Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2
11	PDB:7qfqA	0.105	0.094	3.058E-8	1291	0.023	0.020	7qfqA.pdb.gz
12	PDB:3v0aB	0.124	0.123	3.620E-8	1150	0.024	0.023	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:5n0cA	0.134	0.120	7.111E-8	1293	0.032	0.029	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
14	PDB:3ffzA	0.124	0.114	3.071E-7	1246	0.028	0.026	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
15	PDB:3vv1A	0.091	0.575	2.605E-6	141	0.011	0.085	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
16	PDB:7zl1A	0.101	0.447	7.587E-6	215	0.020	0.107	7zl1A.pdb.gz
17	PDB:1b09A	0.104	0.507	9.501E-6	206	0.014	0.078	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
18	PDB:3wg3A	0.098	0.508	1.490E-5	163	0.009	0.061	3wg3A.pdb.gz	Conformational change of a unique sequence in a fungal galectin from Agrocybe cylindracea controls glycan ligand-binding specificity.
19	PDB:7ufgB	0.111	0.107	3.097E-5	1182	0.016	0.015	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
20	PDB:3zxfB	0.096	0.614	4.592E-5	138	0.013	0.109	3zxfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VF58	0.0	1448	1136	0.831	0.835	COJA1_MOUSE Collagen alpha-1(XIX) chain OS=Mus musculus OX=10090 GN=Col19a1 PE=2 SV=2
2	Q14993	0.0	2161	1142	1.000	1.000	COJA1_HUMAN Collagen alpha-1(XIX) chain OS=Homo sapiens OX=9606 GN=COL19A1 PE=1 SV=3
3	M5BFV8	3.07e-88	315	1622	0.409	0.288	M5BFV8_DANRE Collagen alpha-1(XXII) chain precursor OS=Danio rerio OX=7955 GN=prp PE=1 SV=1
4	E9Q7P1	1.10e-84	305	1613	0.371	0.263	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
5	P08120	4.44e-74	272	1779	0.300	0.193	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
6	Q8NFW1	2.07e-72	267	1626	0.161	0.113	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
7	Q17RW2	6.07e-72	266	1714	0.318	0.212	COOA1_HUMAN Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2
8	Q8BLX7	3.50e-69	257	1580	0.291	0.210	COGA1_MOUSE Collagen alpha-1(XVI) chain OS=Mus musculus OX=10090 GN=Col16a1 PE=1 SV=2
9	A0MSJ1	1.08e-68	255	1658	0.290	0.200	CRA1B_DANRE Collagen alpha-1(XXVII) chain B OS=Danio rerio OX=7955 GN=col27a1b PE=2 SV=1
10	P17139	7.02e-68	253	1759	0.280	0.182	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
11	Q08BP6	2.74e-67	230	290	0.097	0.383	Q08BP6_DANRE Uncharacterized protein LOC768174 precursor OS=Danio rerio OX=7955 GN=zgc:153049 PE=2 SV=1
12	Q9VMV5	3.48e-67	251	1940	0.296	0.174	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
13	O18407	1.97e-65	245	1761	0.300	0.195	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
14	P02466	3.87e-63	238	1372	0.316	0.263	CO1A2_RAT Collagen alpha-2(I) chain OS=Rattus norvegicus OX=10116 GN=Col1a2 PE=1 SV=3
15	Q30D77	5.52e-63	238	1733	0.299	0.197	COOA1_MOUSE Collagen alpha-1(XXIV) chain OS=Mus musculus OX=10090 GN=Col24a1 PE=2 SV=2
16	F5GZK2	1.45e-62	233	956	0.182	0.218	F5GZK2_HUMAN Collagen type XXI alpha 1 chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=1 SV=2
17	A0A158RFW1	4.57e-62	232	957	0.180	0.215	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
18	Q96P44	4.57e-62	232	957	0.180	0.215	COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1
19	P08122	6.41e-62	234	1707	0.301	0.202	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
20	Q07092	7.12e-62	234	1604	0.319	0.227	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1.3e-100	340.4	Collagen triple helix repeat (20 copies)
2	PF13385 Laminin_G_3	5.7	18.5	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263556	0.902	Prolyl 4-hydroxylase subunit alpha-1
2	9606.ENSP00000384999	0.902	Prolyl 4-hydroxylase subunit alpha-2
3	9606.ENSP00000401749	0.902	Prolyl 4-hydroxylase subunit alpha-3
4	9606.ENSP00000417185	0.835	Von Willebrand factor A domain-containing protein 1
5	9606.ENSP00000236040	0.813	Prolyl 3-hydroxylase 1
6	9606.ENSP00000323696	0.800	Cartilage-associated protein
7	9606.ENSP00000434412	0.752	Serpin H1
8	9606.ENSP00000354960	0.687	Procollagen galactosyltransferase 2
9	9606.ENSP00000282903	0.675	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
10	9606.ENSP00000376458	0.673	Cell adhesion molecule-related/down-regulated by oncogenes
11	9606.ENSP00000272133	0.650	Protein cornichon homolog 3
12	9606.ENSP00000383894	0.646	Matrilin-3
13	9606.ENSP00000300026	0.644	Peptidyl-prolyl cis-trans isomerase B
14	9606.ENSP00000316881	0.644	Prolyl 3-hydroxylase 2
15	9606.ENSP00000478600	0.644	Prolyl 3-hydroxylase 3
16	9606.ENSP00000223127	0.628	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
17	9606.ENSP00000216416	0.627	Protein cornichon homolog 1
18	9606.ENSP00000196061	0.625	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
19	9606.ENSP00000327801	0.625	Protein disulfide-isomerase
20	9606.ENSP00000362304	0.622	A disintegrin and metalloproteinase with thrombospondin motifs 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.993	extracellular matrix structural constituent
GO:0030020	0.812	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.982	anatomical structure development
GO:0032501	0.978	multicellular organismal process
GO:0009987	0.969	cellular process
GO:0007275	0.942	multicellular organism development
GO:0048731	0.923	system development
GO:0001501	0.824	skeletal system development
GO:0071840	0.505	cellular component organization or biogenesis
GO:0016043	0.458	cellular component organization
GO:0050789	0.417	regulation of biological process
GO:0050794	0.309	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0005788	0.998	endoplasmic reticulum lumen
GO:0032991	0.990	protein-containing complex
GO:0005581	0.982	collagen trimer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]