StarFunc result for job id Q14994

User Input

>input (352 residues)
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQR
RHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGA
HTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLP
VFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQV
EFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYI
KGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14994	1.000	1.000	2.064E-50	352	1.000	1.000	Q14994.pdb.gz	NR1I3_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=2
2	AFDB:O35627	0.706	0.695	2.477E-38	358	0.739	0.726	O35627.pdb.gz	NR1I3_MOUSE Nuclear receptor subfamily 1 group I member 3 OS=Mus musculus OX=10090 GN=Nr1i3 PE=1 SV=2
3	AFDB:Q9DFH3	0.653	0.591	1.679E-28	391	0.557	0.501	Q9DFH3.pdb.gz	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
4	AFDB:A0A3G3LJZ1	0.826	0.686	1.292E-26	431	0.463	0.378	A0A3G3LJZ1.pdb.gz
5	AFDB:H0Y8E2	0.654	0.585	4.927E-25	397	0.460	0.408	H0Y8E2.pdb.gz	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
6	AFDB:A5J0K7	0.620	0.523	2.727E-24	421	0.466	0.390	A5J0K7.pdb.gz	A5J0K7_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
7	AFDB:F1D8P9	0.669	0.527	3.707E-24	473	0.480	0.357	F1D8P9.pdb.gz	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
8	AFDB:O54915	0.806	0.669	4.418E-24	431	0.472	0.385	O54915.pdb.gz	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
9	AFDB:O42392	0.602	0.477	8.165E-24	451	0.395	0.308	O42392.pdb.gz	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1
10	AFDB:Q1L673	0.620	0.522	8.914E-24	422	0.418	0.348	Q1L673.pdb.gz	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
11	PDB:3dzyA	0.477	0.547	8.053E-12	302	0.222	0.258	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.557	0.797	4.762E-10	238	0.188	0.277	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.447	0.619	7.403E-6	246	0.145	0.207	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.405	0.521	1.124E-4	259	0.105	0.143	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:1is2A	0.140	0.096	1.313E-1	637	0.105	0.058	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
16	PDB:3hajA	0.132	0.155	2.035E-1	286	0.091	0.112	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:7p5jA	0.092	0.086	2.535E-1	399	0.088	0.078	7p5jA.pdb.gz
18	PDB:1szqA	0.108	0.091	3.298E-1	473	0.068	0.051	1szqA.pdb.gz
19	PDB:1keyB	0.144	0.192	3.600E-1	221	0.065	0.104	1keyB.pdb.gz
20	PDB:3lomA	0.119	0.135	3.600E-1	288	0.097	0.118	3lomA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6REZ7	0.0	548	273	0.776	1.000	D6REZ7_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=1
2	E9PCF2	0.0	549	297	0.770	0.912	E9PCF2_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=1
3	O35627	0.0	509	358	0.739	0.726	NR1I3_MOUSE Nuclear receptor subfamily 1 group I member 3 OS=Mus musculus OX=10090 GN=Nr1i3 PE=1 SV=2
4	Q14994	0.0	722	352	1.000	1.000	NR1I3_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=2
5	Q9QUS1	0.0	531	358	0.770	0.757	NR1I3_RAT Nuclear receptor subfamily 1 group I member 3 OS=Rattus norvegicus OX=10116 GN=Nr1i3 PE=2 SV=1
6	B7Z8R7	2.86e-172	480	238	0.656	0.971	B7Z8R7_HUMAN Nuclear receptor subfamily 1 group I member 3 OS=Homo sapiens OX=9606 GN=NR1I3 PE=1 SV=1
7	Q9DFH3	4.32e-111	331	391	0.551	0.496	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
8	H0Y8E2	1.35e-100	304	397	0.457	0.406	H0Y8E2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
9	B0V1H8	3.86e-96	294	430	0.457	0.374	B0V1H8_DANRE Nuclear receptor subfamily 1 group I member 2 isoform X1 OS=Danio rerio OX=7955 GN=PXR PE=3 SV=1
10	A5WYG8	4.91e-95	291	430	0.455	0.372	A5WYG8_DANRE Nuclear receptor subfamily 1 group I member 2 OS=Danio rerio OX=7955 GN=PXR PE=2 SV=1
11	O75469	7.25e-95	291	434	0.466	0.378	NR1I2_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
12	J3KPQ3	8.91e-95	290	434	0.466	0.378	J3KPQ3_HUMAN Nuclear receptor subfamily 1 group I member 2 OS=Homo sapiens OX=9606 GN=NR1I2 PE=1 SV=1
13	A5J0K7	2.63e-94	289	421	0.460	0.385	A5J0K7_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
14	F1D8P9	2.80e-94	290	473	0.466	0.347	F1D8P9_HUMAN Nuclear receptor subfamily 1, group I, member 2, isoform CRA_b OS=Homo sapiens OX=9606 GN=NR1i2 PE=2 SV=1
15	Q9R1A7	3.66e-94	289	431	0.477	0.390	NR1I2_RAT Nuclear receptor subfamily 1 group I member 2 OS=Rattus norvegicus OX=10116 GN=Nr1i2 PE=2 SV=1
16	O54915	1.07e-93	288	431	0.474	0.387	NR1I2_MOUSE Nuclear receptor subfamily 1 group I member 2 OS=Mus musculus OX=10090 GN=Nr1i2 PE=1 SV=1
17	Q2V0W2	1.15e-93	287	421	0.457	0.382	Q2V0W2_PIG Pregnane X receptor OS=Sus scrofa OX=9823 GN=PXR PE=2 SV=1
18	Q1L673	1.78e-79	251	422	0.406	0.339	VDRB_DANRE Vitamin D3 receptor B OS=Danio rerio OX=7955 GN=vdrb PE=2 SV=2
19	Q9PTN2	5.51e-79	250	453	0.406	0.316	VDRA_DANRE Vitamin D3 receptor A OS=Danio rerio OX=7955 GN=vdra PE=1 SV=2
20	O42392	4.02e-78	248	451	0.389	0.304	VDR_CHICK Vitamin D3 receptor OS=Gallus gallus OX=9031 GN=VDR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	8.7e-15	66.4	Ligand-binding domain of nuclear hormone receptor
2	PF04795 PAPA-1	1.4e+02	14.7	PAPA-1-like conserved region
3	PF00105 zf-C4	8.9e-25	98.3	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356959

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342007	0.967	Cytochrome P450 1A2
2	9606.ENSP00000440689	0.961	Cytochrome P450 2E1
3	9606.ENSP00000385216	0.901	Nuclear receptor coactivator 1
4	9606.ENSP00000419692	0.901	Retinoic acid receptor RXR-alpha
5	9606.ENSP00000324648	0.873	Cytochrome P450 2B6
6	9606.ENSP00000399968	0.857	Nuclear receptor coactivator 2
7	9606.ENSP00000337915	0.836	Cytochrome P450 3A4
8	9606.ENSP00000300651	0.814	Mediator of RNA polymerase II transcription subunit 1
9	9606.ENSP00000335153	0.800	Heat shock protein HSP 90-alpha
10	9606.ENSP00000242057	0.778	Aryl hydrocarbon receptor
11	9606.ENSP00000260970	0.743	Peptidyl-prolyl cis-trans isomerase G
12	9606.ENSP00000264867	0.730	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
13	9606.ENSP00000304845	0.726	UDP-glucuronosyltransferase 1-1
14	9606.ENSP00000303174	0.725	UDP-glucuronosyltransferase 1-6
15	9606.ENSP00000222002	0.722	Bile salt sulfotransferase
16	9606.ENSP00000260682	0.718	Cytochrome P450 2C9
17	9606.ENSP00000254227	0.711	Nuclear receptor subfamily 0 group B member 2
18	9606.ENSP00000362549	0.708	UDP-glucuronosyltransferase 1-8
19	9606.ENSP00000369050	0.687	Cytochrome P450 1A1
20	9606.ENSP00000284878	0.684	Coxsackievirus and adenovirus receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0004879	0.996	nuclear receptor activity
GO:0000978	0.958	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.763	DNA-binding transcription activator activity
GO:0008134	0.328	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.987	cellular process
GO:0050896	0.979	response to stimulus
GO:0009889	0.977	regulation of biosynthetic process
GO:0050794	0.955	regulation of cellular process
GO:0080090	0.932	regulation of primary metabolic process
GO:0031323	0.931	regulation of cellular metabolic process
GO:0031326	0.914	regulation of cellular biosynthetic process
GO:0051171	0.909	regulation of nitrogen compound metabolic process
GO:0010556	0.903	regulation of macromolecule biosynthetic process
GO:0051252	0.897	regulation of RNA metabolic process
GO:0010468	0.894	regulation of gene expression
GO:2001141	0.892	regulation of RNA biosynthetic process
GO:0006355	0.878	regulation of DNA-templated transcription
GO:0048518	0.865	positive regulation of biological process
GO:0051716	0.781	cellular response to stimulus
GO:0008152	0.747	metabolic process
GO:0045944	0.716	positive regulation of transcription by RNA polymerase II
GO:0071704	0.692	organic substance metabolic process
GO:0007165	0.630	signal transduction
GO:0044237	0.555	cellular metabolic process
GO:0044238	0.475	primary metabolic process
GO:0042221	0.436	response to chemical
GO:0070887	0.404	cellular response to chemical stimulus
GO:1901360	0.300	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.835	cytoplasm
GO:0016020	0.426	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]