StarFunc result for job id Q14995

User Input

>input (579 residues)
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
ANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKS
SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVCPLSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI
MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8P2	0.535	0.535	1.980E-69	579	0.998	0.998	F1D8P2.pdb.gz	F1D8P2_HUMAN Nuclear receptor Rev-ErbA beta variant 1 OS=Homo sapiens OX=9606 GN=NR1D2 PE=2 SV=1
2	AFDB:B3DHW0	0.490	0.554	3.911E-39	504	0.523	0.601	B3DHW0.pdb.gz
3	AFDB:P35398	0.302	0.333	4.198E-23	523	0.278	0.308	P35398.pdb.gz	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
4	AFDB:P13055	0.357	0.151	1.303E-20	1412	0.297	0.122	P13055.pdb.gz	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
5	AFDB:F1D8P7	0.332	0.414	1.957E-20	461	0.218	0.273	F1D8P7.pdb.gz	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
6	AFDB:O00482	0.284	0.303	3.222E-19	541	0.233	0.250	O00482.pdb.gz	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
7	AFDB:B3DKN2	0.279	0.300	2.352E-18	537	0.202	0.218	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
8	AFDB:P22605	0.336	0.399	2.694E-18	482	0.233	0.280	P22605.pdb.gz	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1
9	AFDB:Q9DFH3	0.324	0.470	5.305E-18	391	0.190	0.281	Q9DFH3.pdb.gz	Q9DFH3_CHICK Xenobiotic receptor OS=Gallus gallus OX=9031 GN=CXR PE=2 SV=1
10	AFDB:A0A3G3LJZ1	0.333	0.441	9.122E-18	431	0.212	0.285	A0A3G3LJZ1.pdb.gz
11	PDB:3dzyA	0.298	0.554	7.012E-13	302	0.176	0.338	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.290	0.681	9.225E-11	238	0.105	0.256	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.289	0.648	2.187E-7	246	0.083	0.195	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.252	0.537	8.903E-5	259	0.069	0.154	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:3pjaL	0.075	0.143	9.807E-1	223	0.040	0.103	3pjaL.pdb.gz
16	PDB:3b9yA	0.094	0.122	2.314	388	0.028	0.041	3b9yA.pdb.gz
17	PDB:6pvqA	0.070	0.072	2.314	562	0.041	0.043	6pvqA.pdb.gz
18	PDB:8d3xA	0.119	0.079	2.314	989	0.031	0.018	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
19	PDB:3f29B	0.068	0.074	2.533	520	0.036	0.040	3f29B.pdb.gz	Binding of sulfite by the Thioalkalivibrio nitratireducens cytochrome c nitrite reductase
20	PDB:5nrlA	0.089	0.035	2.772	2216	0.031	0.008	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1D8P2	0.0	1207	579	0.998	0.998	F1D8P2_HUMAN Nuclear receptor Rev-ErbA beta variant 1 OS=Homo sapiens OX=9606 GN=NR1D2 PE=2 SV=1
2	Q14995	0.0	1207	579	0.998	0.998	NR1D2_HUMAN Nuclear receptor subfamily 1 group D member 2 OS=Homo sapiens OX=9606 GN=NR1D2 PE=1 SV=4
3	Q60674	0.0	1042	576	0.907	0.911	NR1D2_MOUSE Nuclear receptor subfamily 1 group D member 2 OS=Mus musculus OX=10090 GN=Nr1d2 PE=1 SV=1
4	Q6NSM0	0.0	801	408	0.660	0.936	Q6NSM0_HUMAN NR1D2 protein OS=Homo sapiens OX=9606 GN=NR1D2 PE=1 SV=1
5	Q3UV55	2.07e-168	494	615	0.527	0.496	NR1D1_MOUSE Nuclear receptor subfamily 1 group D member 1 OS=Mus musculus OX=10090 GN=Nr1d1 PE=1 SV=1
6	Q63503	1.02e-167	492	615	0.541	0.509	NR1D1_RAT Nuclear receptor subfamily 1 group D member 1 OS=Rattus norvegicus OX=10116 GN=Nr1d1 PE=1 SV=2
7	F1D8S3	2.13e-167	491	614	0.530	0.500	F1D8S3_HUMAN Nuclear receptor Rev-ErbA-alpha OS=Homo sapiens OX=9606 GN=NR1D1 PE=2 SV=1
8	P20393	2.13e-167	491	614	0.530	0.500	NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 OS=Homo sapiens OX=9606 GN=NR1D1 PE=1 SV=1
9	F1QIC9	2.88e-112	346	504	0.295	0.339	F1QIC9_DANRE Nuclear receptor subfamily 1, group D, member 2a OS=Danio rerio OX=7955 GN=NR1D2-A PE=3 SV=2
10	F1RAU6	8.62e-97	310	637	0.306	0.278	F1RAU6_DANRE Nuclear receptor subfamily 1 group D member 1 OS=Danio rerio OX=7955 GN=Eip75B PE=3 SV=1
11	P17671	3.10e-47	180	1199	0.126	0.061	E75BC_DROME Ecdysone-induced protein 75B, isoforms C/D OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
12	P13055	3.61e-47	180	1412	0.126	0.052	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
13	F1QLY4	2.11e-39	152	468	0.140	0.173	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
14	F1LZZ3	1.81e-38	149	467	0.133	0.165	F1LZZ3_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=3
15	A0A0C4DG53	1.88e-38	149	468	0.133	0.165	A0A0C4DG53_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
16	A0A8I6A803	2.43e-38	150	523	0.133	0.147	A0A8I6A803_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=1
17	P51448	2.52e-38	150	523	0.133	0.147	RORA_MOUSE Nuclear receptor ROR-alpha OS=Mus musculus OX=10090 GN=Rora PE=1 SV=1
18	P35398	2.60e-38	150	523	0.133	0.147	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
19	A0A0C4DFP5	1.05e-37	149	548	0.133	0.141	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
20	Q8R1B8	8.93e-37	144	470	0.128	0.157	RORB_MOUSE Nuclear receptor ROR-beta OS=Mus musculus OX=10090 GN=Rorb PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	8.1e-21	86.1	Ligand-binding domain of nuclear hormone receptor
2	PF04613 LpxD	1.3e+02	13.8	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
3	PF00105 zf-C4	1.1e-27	107.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222122	0.921	D site-binding protein
2	9606.ENSP00000268712	0.914	Nuclear receptor corepressor 1
3	9606.ENSP00000482093	0.900	Period circadian protein homolog 3
4	9606.ENSP00000384517	0.892	Aryl hydrocarbon receptor nuclear translocator-like protein 1
5	9606.ENSP00000008527	0.873	Cryptochrome-1
6	9606.ENSP00000308741	0.852	Circadian locomoter output cycles protein kaput
7	9606.ENSP00000478187	0.847	Cryptochrome-2
8	9606.ENSP00000362649	0.828	Histone deacetylase 1
9	9606.ENSP00000256495	0.823	Class E basic helix-loop-helix protein 40
10	9606.ENSP00000338283	0.823	Neuronal PAS domain-containing protein 2
11	9606.ENSP00000242728	0.818	Class E basic helix-loop-helix protein 41
12	9606.ENSP00000254657	0.817	Period circadian protein homolog 2
13	9606.ENSP00000297689	0.808	Nuclear factor interleukin-3-regulated protein
14	9606.ENSP00000266304	0.805	Thyrotroph embryonic factor
15	9606.ENSP00000314420	0.765	Period circadian protein homolog 1
16	9606.ENSP00000246672	0.756	Nuclear receptor subfamily 1 group D member 1
17	9606.ENSP00000380044	0.749	Casein kinase I isoform epsilon
18	9606.ENSP00000384018	0.705	Nuclear receptor corepressor 2
19	9606.ENSP00000266503	0.704	Aryl hydrocarbon receptor nuclear translocator-like protein 2
20	9606.ENSP00000339390	0.665	Cadherin-like protein 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.999	protein binding
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0098531	0.848	ligand-activated transcription factor activity
GO:0038023	0.726	signaling receptor activity
GO:0004879	0.666	nuclear receptor activity
GO:0008134	0.388	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0051171	0.998	regulation of nitrogen compound metabolic process
GO:0010468	0.997	regulation of gene expression
GO:0010556	0.997	regulation of macromolecule biosynthetic process
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.989	negative regulation of cellular process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0009892	0.959	negative regulation of metabolic process
GO:0010605	0.920	negative regulation of macromolecule metabolic process
GO:0031327	0.871	negative regulation of cellular biosynthetic process
GO:0051172	0.869	negative regulation of nitrogen compound metabolic process
GO:0045892	0.863	negative regulation of DNA-templated transcription
GO:0006357	0.658	regulation of transcription by RNA polymerase II
GO:0048518	0.433	positive regulation of biological process
GO:0009987	0.425	cellular process
GO:0008152	0.351	metabolic process
GO:0000122	0.341	negative regulation of transcription by RNA polymerase II
GO:0048522	0.334	positive regulation of cellular process
GO:0010604	0.327	positive regulation of macromolecule metabolic process
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process
GO:0009891	0.309	positive regulation of biosynthetic process
GO:0031325	0.302	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.936	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]