StarFunc result for job id Q14997

User Input

>input (1843 residues)
MEPAERAGVGEPPEPGGRPEPGPRGFVPQKEIVYNKLLPYAERLDAESDLQLAQIKCNLG
RAVQLQELWPGGLFWTRKLSTYIRLYGRKFSKEDHVLFIKLLYELVSIPKLEISMMQGFA
RLLINLLKKKELLSRADLELPWRPLYDMVERILYSKTEHLGLNWFPNSVENILKTLVKSC
RPYFPADATAEMLEEWRPLMCPFDVTMQKAITYFEIFLPTSLPPELHHKGFKLWFDELIG
LWVSVQNLPQWEGQLVNLFARLATDNIGYIDWDPYVPKIFTRILRSLNLPVGSSQVLVPR
FLTNAYDIGHAVIWITAMMGGPSKLVQKHLAGLFNSITSFYHPSNNGRWLNKLMKLLQRL
PNSVVRRLHRERYKKPSWLTPVPDSHKLTDQDVTDFVQCIIQPVLLAMFSKTGSLEAAQA
LQNLALMRPELVIPPVLERTYPALETLTEPHQLTATLSCVIGVARSLVSGGRWFPEGPTH
MLPLLMRALPGVDPNDFSKCMITFQFIATFSTLVPLVDCSSVLQERNDLTEVERELCSAT
AEFEDFVLQFMDRCFGLIESSTLEQTREETETEKMTHLESLVELGLSSTFSTILTQCSKE
IFMVALQKVFNFSTSHIFETRVAGRMVADMCRAAVKCCPEESLKLFVPHCCSVITQLTMN
DDVLNDEELDKELLWNLQLLSEITRVDGRKLLLYREQLVKILQRTLHLTCKQGYTLSCNL
LHHLLRSTTLIYPTEYCSVPGGFDKPPSEYFPIKDWGKPGDLWNLGIQWHVPSSEEVSFA
FYLLDSFLQPELVKLQHCGDGKLEMSRDDILQSLTIVHNCLIGSGNLLPPLKGEPVTNLV
PSMVSLEETKLYTGLEYDLSRENHREVIATVIRKLLNHILDNSEDDTKSLFLIIKIIGDL
LQFQGSHKHEFDSRWKSFNLVKKSMENRLHGKKQHIRALLIDRVMLQHELRTLTVEGCEY
KKIHQDMIRDLLRLSTSSYSQVRNKAQQTFFAALGAYNFCCRDIIPLVLEFLRPDRQGVT
QQQFKGALYCLLGNHSGVCLANLHDWDCIVQTWPAIVSSGLSQAMSLEKPSIVRLFDDLA
EKIHRQYETIGLDFTIPKSCVEIAELLQQSKNPSINQILLSPEKIKEGIKRQQEKNADAL
RNYENLVDTLLDGVEQRNLPWKFEHIGIGLLSLLLRDDRVLPLRAIRFFVENLNHDAIVV
RKMAISAVAGILKQLKRTHKKLTINPCEISGCPKPTQIIAGDRPDNHWLHYDSKTIPRTK
KEWESSCFVEKTHWGYYTWPKNMVVYAGVEEQPKLGRSREDMTEAEQIIFDHFSDPKFVE
QLITFLSLEDRKGKDKFNPRRFCLFKGIFRNFDDAFLPVLKPHLEHLVADSHESTQRCVA
EIIAGLIRGSKHWTFEKVEKLWELLCPLLRTALSNITVETYNDWGACIATSCESRDPRKL
HWLFELLLESPLSGEGGSFVDACRLYVLQGGLAQQEWRVPELLHRLLKYLEPKLTQVYKN
VRERIGSVLTYIFMIDVSLPNTTPTISPHVPEFTARILEKLKPLMDVDEEIQNHVMEENG
IGEEDERTQGIKLLKTILKWLMASAGRSFSTAVTEQLQLLPLFFKIAPVENDNSYDELKR
DAKLCLSLMSQGLLYPHQVPLVLQVLKQTARSSSWHARYTVLTYLQTMVFYNLFIFLNNE
DAVKDIRWLVISLLEDEQLEVREMAATTLSGLLQCNFLTMDSPMQIHFEQLCKTKLPKKR
KRDPGSVGDTIPSAELVKRHAGVLGLGACVLSSPYDVPTWMPQLLMNLSAHLNDPQPIEM
TVKKTLSNFRRTHHDNWQEHKQQFTDDQLLVLTDLLVSPCYYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6kwyc	0.981	0.998	0.000	1811	0.980	0.998	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
2	PDB:6reyc	0.957	0.995	0.000	1773	0.951	0.989	6reyc.pdb.gz	Characterization of Fully Recombinant Human 20S and 20S-PA200 Proteasome Complexes.
3	AFDB:Q14997	1.000	1.000	0.000	1843	1.000	1.000	Q14997.pdb.gz	PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2
4	AFDB:P43583	0.759	0.658	6.042E-42	2143	0.170	0.147	P43583.pdb.gz	BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
5	AFDB:E9PVA8	0.136	0.107	3.728E-12	2671	0.118	0.081	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
6	AFDB:Q9P7H8	0.149	0.161	4.007E-12	1679	0.114	0.126	Q9P7H8.pdb.gz	ECM29_SCHPO Proteasome component ecm29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ecm29 PE=1 SV=1
7	AFDB:P33892	0.155	0.122	6.886E-12	2672	0.124	0.085	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
8	AFDB:Q9R0L4	0.184	0.245	8.248E-12	1273	0.092	0.133	Q9R0L4.pdb.gz	CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus OX=10116 GN=Cand2 PE=1 SV=1
9	AFDB:P32337	0.174	0.261	9.192E-12	1089	0.076	0.129	P32337.pdb.gz	IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSE1 PE=1 SV=2
10	AFDB:A0A1D8PKU7	0.162	0.161	1.101E-11	1859	0.130	0.129	A0A1D8PKU7.pdb.gz	A0A1D8PKU7_CANAL Ecm29p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ECM29 PE=4 SV=1
11	AFDB:Q95Q95	0.142	0.112	1.101E-11	2697	0.118	0.081	Q95Q95.pdb.gz	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
12	AFDB:O75155	0.214	0.299	1.319E-11	1236	0.083	0.124	O75155.pdb.gz	CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2 PE=1 SV=3
13	PDB:4a0cA	0.190	0.277	1.578E-11	1155	0.096	0.153	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6xu2A	0.161	0.248	2.454E-10	1091	0.092	0.156	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:7mqaLM	0.139	0.128	3.275E-10	2041	0.124	0.112	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6x9oA	0.129	0.111	4.217E-10	2425	0.146	0.111	6x9oA.pdb.gz
17	PDB:6ez8A	0.112	0.094	8.077E-10	2353	0.139	0.109	6ez8A.pdb.gz
18	PDB:6yejA	0.133	0.124	9.331E-10	2046	0.136	0.123	6yejA.pdb.gz
19	PDB:7mq8SP	0.123	0.117	1.547E-9	1993	0.112	0.104	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7k1jA	0.130	0.086	2.219E-9	3584	0.137	0.070	7k1jA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14997	0.0	3805	1843	1.000	1.000	PSME4_HUMAN Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2
2	Q5SSW2	0.0	3580	1843	0.957	0.957	PSME4_MOUSE Proteasome activator complex subunit 4 OS=Mus musculus OX=10090 GN=Psme4 PE=1 SV=1
3	P43583	4.97e-07	57.8	2143	0.060	0.052	BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
4	Q8BLK9	1.1	36.6	1056	0.020	0.034	KS6C1_MOUSE Ribosomal protein S6 kinase delta-1 OS=Mus musculus OX=10090 GN=Rps6kc1 PE=1 SV=2
5	Q96S38	1.5	36.2	1066	0.020	0.034	KS6C1_HUMAN Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=2
6	O77323	2.3	35.4	539	0.011	0.039	TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=MAL3P3.6 PE=3 SV=1
7	Q580A5	2.8	35.4	1286	0.011	0.016	Q580A5_TRYB2 Ubiquitin-protein ligase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.890 PE=4 SV=1
8	A7T1N0	3.8	35.0	1551	0.014	0.017	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
9	Q7TNP2	4.6	34.3	601	0.020	0.060	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
10	O60068	7.7	31.6	102	0.015	0.265	ISD11_SCHPO Protein isd11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isd11 PE=3 SV=1
11	Q8TD43	10.0	33.5	1214	0.015	0.022	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16507 BLM10_mid	1.2e-114	395.5	Proteasome-substrate-size regulator, mid region
2	PF11919 DUF3437	6.2e-33	123.8	Domain of unknown function (DUF3437)
3	PF00038 Filament	2.8e+02	12.5	Intermediate filament protein
4	PF02985 HEAT	0.0016	29.5	HEAT repeat
5	PF13646 HEAT_2	41	16.0	HEAT repeats

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384211

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414359	0.999	Proteasome subunit alpha type-1
2	9606.ENSP00000262193	0.998	Proteasome subunit beta type-1
3	9606.ENSP00000290541	0.998	Proteasome subunit beta type-4
4	9606.ENSP00000362334	0.998	Proteasome subunit beta type-2
5	9606.ENSP00000259457	0.997	Proteasome subunit beta type-7
6	9606.ENSP00000270586	0.997	Proteasome subunit beta type-6
7	9606.ENSP00000271308	0.997	Proteasome subunit alpha type-5
8	9606.ENSP00000483688	0.997	Proteasome subunit beta type-3
9	9606.ENSP00000216455	0.996	Proteasome subunit alpha type-3
10	9606.ENSP00000223321	0.996	Proteasome subunit alpha type-2
11	9606.ENSP00000359910	0.996	Proteasome subunit alpha type-7
12	9606.ENSP00000401802	0.995	26S proteasome regulatory subunit 10B
13	9606.ENSP00000044462	0.994	Proteasome subunit alpha type-4
14	9606.ENSP00000363993	0.994	Proteasome subunit beta type-9
15	9606.ENSP00000355325	0.993	Proteasome subunit beta type-5
16	9606.ENSP00000261479	0.992	Proteasome subunit alpha type-6
17	9606.ENSP00000311121	0.987	Proteasome subunit alpha type-7-like
18	9606.ENSP00000386541	0.987	26S proteasome non-ATPase regulatory subunit 14
19	9606.ENSP00000357879	0.986	26S proteasome non-ATPase regulatory subunit 4
20	9606.ENSP00000264639	0.978	26S proteasome non-ATPase regulatory subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.327	molecular function regulator activity
GO:0008047	0.317	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0009987	0.987	cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0044238	0.984	primary metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0044260	0.962	cellular macromolecule metabolic process
GO:1901564	0.910	organonitrogen compound metabolic process
GO:0000003	0.902	reproduction
GO:0034641	0.890	cellular nitrogen compound metabolic process
GO:0050896	0.889	response to stimulus
GO:0090304	0.881	nucleic acid metabolic process
GO:0032501	0.880	multicellular organismal process
GO:0051716	0.871	cellular response to stimulus
GO:0022414	0.841	reproductive process
GO:0032504	0.809	multicellular organism reproduction
GO:0019538	0.809	protein metabolic process
GO:0007276	0.767	gamete generation
GO:0071840	0.727	cellular component organization or biogenesis
GO:0032502	0.681	developmental process
GO:0016043	0.631	cellular component organization
GO:0009056	0.608	catabolic process
GO:0006508	0.591	proteolysis
GO:0009057	0.583	macromolecule catabolic process
GO:0030154	0.568	cell differentiation
GO:0048856	0.541	anatomical structure development
GO:0033554	0.541	cellular response to stress
GO:0007289	0.532	spermatid nucleus differentiation
GO:0006974	0.518	cellular response to DNA damage stimulus
GO:0006259	0.509	DNA metabolic process
GO:0051603	0.479	proteolysis involved in protein catabolic process
GO:0065007	0.423	biological regulation
GO:0050789	0.414	regulation of biological process
GO:0010498	0.397	proteasomal protein catabolic process
GO:0006325	0.344	chromatin organization
GO:0006281	0.304	DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:1902494	0.966	catalytic complex
GO:0000502	0.960	proteasome complex
GO:0043232	0.433	intracellular non-membrane-bounded organelle
GO:0012505	0.394	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]