StarFunc result for job id Q14999

User Input

>input (1698 residues)
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGDGGSGQVDC
KAEHILLWMSKDEIYANCHKMLGEDGQVIGPSQESAGEVGALDKSVLEEMETDVKSLIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRVLFSLVKRYLHVTSLLDQLNDSAAEPGAQNTSAPEELSGERGQLELEFSMAM
GTLISELVQAMRWDQASDRPRSSARSPGSIFQPQLADVSPGLPAAQAQPSFRRSRRFRPR
SEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRT
YWVHWHMLEILGFEEDIEDMVEADEYQGAVASRVLGRALPAWRWRPMTELYAVPYVLPED
EDTEECEHLTLAEWWELLFFIKKLDGPDHQEVLQILQENLDGEILDDEILAELAVPIELA
QDLLLTLPQRLNDSALRDLINCHVYKKYGPEALAGNQAYPSLLEAQEDVLLLDAQAQAKD
SEDAAKVEAKEPPSQSPNTPLQRLVEGYGPAGKILLDLEQALSSEGTQENKVKPLLLQLQ
RQPQPFLALMQSLDTPETNRTLHLTVLRILKQLVDFPEALLLPWHEAVDACMACLRSPNT
DREVLQELIFFLHRLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCE
KHAHLYRKLITNILGGCIQMVLGQIEDHRRTHQPINIPFFDVFLRYLCQGSSVEVKEDKC
WEKVEVSSNPHRASKLTDHNPKTYWESNGSAGSHYITLHMRRGILIRQLTLLVASEDSSY
MPARVVVCGGDSTSSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTR
IRGLEILGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDMAEDRRSLLHLSSRLNGALRQ
EQNFADRFLPDDEAAQALGKTCWEALVSPVVQNITSPDEDGISPLGWLLDQYLECQEAVF
NPQSRGPAFFSRVRRLTHLLVHVEPCEAPPPVVATPRPKGRNRSHDWSSLATRGLPSSIM
RNLTRCWRAVVEKQVNNFLTSSWRDDDFVPRYCEHFNILQNSSSELFGPRAAFLLALQNG
CAGALLKLPFLKAAHVSEQFARHIDQQIQGSRIGGAQEMERLAQLQQCLQAVLIFSGLEI
ATTFEHYYQHYMADRLLGVVSSWLEGAVLEQIGPCFPNRLPQQMLQSLSTSKELQRQFHV
YQLQQLDQELLKLEDTEKKIQVGLGASGKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDL
YYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALER
GSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYLNDLKAVSVESLLAFSGLSADMLNQ
AIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEDGQNL
EKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTD
VLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRS
RGVPYASCTATQSFSTFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8bC	0.603	0.824	0.000	1224	0.717	0.995	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
2	AFDB:D3ZEF4	0.798	0.801	0.000	1692	0.798	0.801	D3ZEF4.pdb.gz	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
3	AFDB:Q14999	1.000	1.000	0.000	1698	1.000	1.000	Q14999.pdb.gz	CUL7_HUMAN Cullin-7 OS=Homo sapiens OX=9606 GN=CUL7 PE=1 SV=2
4	AFDB:Q8IWT3	0.611	0.436	0.000	2517	0.599	0.404	Q8IWT3.pdb.gz	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
5	AFDB:Q8VE73	0.804	0.808	0.000	1689	0.774	0.779	Q8VE73.pdb.gz	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
6	AFDB:Q17390	0.284	0.535	1.174E-13	791	0.083	0.178	Q17390.pdb.gz	CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans OX=6239 GN=cul-2 PE=1 SV=4
7	AFDB:Q24311	0.275	0.526	1.801E-13	774	0.091	0.199	Q24311.pdb.gz	CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Cul1 PE=1 SV=2
8	AFDB:O13790	0.279	0.541	4.236E-13	767	0.088	0.194	O13790.pdb.gz	CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul1 PE=1 SV=1
9	PDB:1ldjA	0.260	0.528	4.836E-13	725	0.096	0.225	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
10	AFDB:O60999	0.265	0.506	5.350E-13	770	0.091	0.201	O60999.pdb.gz	CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum OX=44689 GN=culA PE=1 SV=1
11	AFDB:Q57YJ8	0.265	0.525	1.077E-12	742	0.081	0.185	Q57YJ8.pdb.gz	Q57YJ8_TRYB2 Cullin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.900 PE=3 SV=1
12	PDB:6ttuC	0.249	0.526	3.007E-12	701	0.090	0.218	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
13	AFDB:Q13619	0.244	0.459	7.824E-12	759	0.084	0.187	Q13619.pdb.gz	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
14	PDB:6v9iC	0.258	0.511	3.453E-10	730	0.075	0.174	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
15	PDB:4a0kA	0.218	0.446	5.412E-8	719	0.062	0.147	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
16	PDB:6r6hO	0.223	0.451	4.052E-6	745	0.054	0.122	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:7qe7L	0.076	0.650	6.214E-6	183	0.021	0.197	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:6tm5N	0.117	0.264	2.074E-5	676	0.058	0.146	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
19	PDB:7qe7N	0.149	0.318	4.176E-5	682	0.074	0.183	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:5lcwN	0.132	0.282	4.514E-5	703	0.058	0.141	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZEF4	0.0	2642	1692	0.794	0.797	CUL7_RAT Cullin-7 OS=Rattus norvegicus OX=10116 GN=Cul7 PE=1 SV=1
2	E9PEZ1	0.0	1288	2489	0.389	0.265	E9PEZ1_HUMAN Cullin 9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=1
3	Q14999	0.0	3492	1698	1.000	1.000	CUL7_HUMAN Cullin-7 OS=Homo sapiens OX=9606 GN=CUL7 PE=1 SV=2
4	Q8IWT3	0.0	1316	2517	0.395	0.267	CUL9_HUMAN Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2
5	Q8VE73	0.0	2585	1689	0.769	0.773	CUL7_MOUSE Cullin-7 OS=Mus musculus OX=10090 GN=Cul7 PE=1 SV=2
6	Q5SSH7	5.34e-21	103	2924	0.032	0.019	ZZEF1_MOUSE Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zzef1 PE=1 SV=2
7	O43149	2.43e-20	101	2961	0.032	0.018	ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6
8	Q3U487	2.79e-20	100	861	0.031	0.062	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
9	Q5T447	1.29e-19	98.2	861	0.031	0.060	HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1
10	O95714	1.50e-19	99.0	4834	0.031	0.011	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
11	Q4U2R1	1.46e-17	92.4	4836	0.029	0.010	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
12	Q802D4	1.04e-08	62.8	774	0.048	0.105	Q802D4_DANRE Cul1b protein OS=Danio rerio OX=7955 GN=zgc:111899 PE=1 SV=1
13	Q13616	1.64e-08	62.0	776	0.037	0.081	CUL1_HUMAN Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2
14	Q9WTX6	1.67e-08	62.0	776	0.037	0.081	CUL1_MOUSE Cullin-1 OS=Mus musculus OX=10090 GN=Cul1 PE=1 SV=1
15	Q6NYS3	8.62e-08	59.7	777	0.047	0.102	Q6NYS3_DANRE Cullin 1a OS=Danio rerio OX=7955 GN=Cul1 PE=1 SV=1
16	Q9ZPW2	2.29e-05	49.3	192	0.024	0.208	APC10_ARATH Anaphase-promoting complex subunit 10 OS=Arabidopsis thaliana OX=3702 GN=APC10 PE=1 SV=2
17	Q17389	4.13e-05	50.8	780	0.028	0.060	CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans OX=6239 GN=cul-1 PE=1 SV=1
18	Q8K2H6	1.18e-04	47.0	185	0.022	0.205	APC10_MOUSE Anaphase-promoting complex subunit 10 OS=Mus musculus OX=10090 GN=Anapc10 PE=1 SV=1
19	Q9UM13	1.98e-04	46.6	185	0.022	0.205	APC10_HUMAN Anaphase-promoting complex subunit 10 OS=Homo sapiens OX=9606 GN=ANAPC10 PE=1 SV=1
20	Q17390	0.17	39.3	791	0.022	0.048	CUL2_CAEEL Cullin-2 OS=Caenorhabditis elegans OX=6239 GN=cul-2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03256 ANAPC10	2.5e-06	38.8	Anaphase-promoting complex, subunit 10 (APC10)
2	PF11515 Cul7	6.6e-30	114.6	Mouse development and cellular proliferation protein Cullin-7
3	PF00888 Cullin	1.6e-18	78.4	Cullin family
4	PF10557 Cullin_Nedd8	0.015	26.7	Cullin protein neddylation domain
5	PF08940 DUF1918	3.2e+02	12.4	Domain of unknown function (DUF1918)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
3	9606.ENSP00000310686	0.999	F-box/WD repeat-containing protein 8
4	9606.ENSP00000385636	0.999	Obscurin-like protein 1
5	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
6	9606.ENSP00000303158	0.995	Coiled-coil domain-containing protein 8
7	9606.ENSP00000359385	0.988	Glomulin
8	9606.ENSP00000478501	0.960	Anaphase-promoting complex subunit 10
9	9606.ENSP00000252050	0.949	Cullin-9
10	9606.ENSP00000349957	0.938	Anaphase promoting complex subunit 11
11	9606.ENSP00000394394	0.932	Anaphase-promoting complex subunit 7
12	9606.ENSP00000304895	0.927	Insulin receptor substrate 1
13	9606.ENSP00000363787	0.919	E3 ubiquitin-protein ligase RING1
14	9606.ENSP00000264552	0.918	Ubiquitin-conjugating enzyme E2 S
15	9606.ENSP00000314004	0.915	Anaphase-promoting complex subunit 2
16	9606.ENSP00000418960	0.913	Breast cancer type 1 susceptibility protein
17	9606.ENSP00000353549	0.911	Cell division cycle protein 16 homolog
18	9606.ENSP00000356480	0.910	E3 ubiquitin-protein ligase RING2
19	9606.ENSP00000260947	0.907	BRCA1-associated RING domain protein 1
20	9606.ENSP00000426654	0.907	Anaphase-promoting complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.695	catalytic activity
GO:0140096	0.688	catalytic activity, acting on a protein
GO:0016740	0.666	transferase activity
GO:0019787	0.601	ubiquitin-like protein transferase activity
GO:0004842	0.467	ubiquitin-protein transferase activity
GO:0019899	0.302	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0070647	0.977	protein modification by small protein conjugation or removal
GO:0050794	0.976	regulation of cellular process
GO:0048518	0.887	positive regulation of biological process
GO:0032446	0.879	protein modification by small protein conjugation
GO:0016043	0.878	cellular component organization
GO:0048522	0.877	positive regulation of cellular process
GO:0032502	0.831	developmental process
GO:0016567	0.807	protein ubiquitination
GO:0051128	0.779	regulation of cellular component organization
GO:0006996	0.763	organelle organization
GO:0051239	0.664	regulation of multicellular organismal process
GO:0048856	0.663	anatomical structure development
GO:0048814	0.657	regulation of dendrite morphogenesis
GO:0050775	0.641	positive regulation of dendrite morphogenesis
GO:0051726	0.602	regulation of cell cycle
GO:0048869	0.554	cellular developmental process
GO:0044237	0.518	cellular metabolic process
GO:0030154	0.509	cell differentiation
GO:0010564	0.459	regulation of cell cycle process
GO:0033043	0.386	regulation of organelle organization
GO:0007346	0.358	regulation of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0031461	1.000	cullin-RING ubiquitin ligase complex
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005829	0.961	cytosol
GO:0012505	0.952	endomembrane system
GO:0005634	0.840	nucleus
GO:0070013	0.807	intracellular organelle lumen
GO:0031981	0.803	nuclear lumen
GO:0005815	0.688	microtubule organizing center
GO:0005813	0.671	centrosome
GO:0005654	0.592	nucleoplasm
GO:0005794	0.509	Golgi apparatus
GO:0048471	0.485	perinuclear region of cytoplasm
GO:0031467	0.466	Cul7-RING ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.666	Transferases.

[back to server]