StarFunc result for job id Q149M9

User Input

>input (1564 residues)
MQRGKPCRALPTLKCQTFCQRHGLMFEVVDLRWGIRNIEATDHLTTELCLEEVDRCWKTS
IGPAFVALIGDQYGPCLIPSRIDEKEWEVLRDHLTARPSDLELVARYFQRDENAFPPTYV
LQAPGTGEACEPEEATLTSVLRSGAQEARRLGLITQEQWQHYHRSVIEWEIERSLLSSED
REQGATVFLREIQDLHKHILEDCALRMVDRLADGCLDADAQNLLSSLKSHITDMHPGVLK
THRLPWSRDLVNPKNKTHACYLKELGEQFVVRANHQVLTRLRELDTAGQELAWLYQEIRH
HLWQSSEVIQTFCGRQELLARLGQQLRHDDSKQHTPLVLFGPPGIGKTALMCKLAEQMPR
LLGHKTVTVLRLLGTSQMSSDARGLLKSICFQVCLAYGLPLPPAQVLDAHTRVVQFFHTL
LHTVSCRNFESLVLLLDAMDDLDSVRHARRVPWLPLNCPPRVHLILSACSGALGVLDTLQ
RVLLDPEAYWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAF
EEARKWASFTVPVPLATTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSEAELKD
VLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQL
VEVVRERYLSGSERAKRHGVLADFFSGTWSQGTKKLITLPLVGKPLNLDRKVAPQPLWFS
HTVANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLD
SPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQSWFQL
CAHPVLVPLGGFLQPPGGPLRATLSGCHKGITAMAWGVEEKLLVIGTQDGIMAVWDMEEQ
HVIHMLTGHTGEVRCVKIFAKGTLANSASKDYTLHLWNLLSGQEKFTIWDGGSKNPAEPQ
IWNLHVDEAHKVVYSASGSKINAWNLETAEPVFHILGDASDPWMCMAVLASQATLLTVSR
DGVVSLWSSATGKLQGKQHMSSIKEETPTCAVSVQKQGKLVTGFSNGSISLVSSKGDRLL
EKLPDAVRFLVVSEDESLLAAGFGRSVRIFLADSRGFRRFMAMDLEHEDMVETAVFGTEN
NLIITGSLDALIQVWSLSEQGTLLDILEGVGAPVSLLARGGALVASASPQSSSFKVWDLS
DAHRSRVPAPFLDRTGLTAVSHNGSYVYFPKIGDKNKVTIWDLAEGEEQDSLDTSSEIRC
LEVAEQRKLLFTGLVSGVVLVFPLNSRQDVICIPPPEARKAINCMSLSKCEDRLAIAYDN
IVLVLDITSGDPCPVIDGPRYTFYTQLPETLSSVAILTDYRVVYSMTNGDLFLYECATSK
AFPLETHRSRVACVEVSHKEQLVVSGSEDALLCLWDLQARKWKFEMSYTSSYCRGVQCAC
FSKDDKYVYVGLKDRSILVWSVLDGTLLTVQFVHAVVNRIIPTTSGFIAPTRHGYLIREN
FQCLSAKASPQDPLKNFKKAMWMVKSRQREELVAAAGAPQDLESESAQGNETKSNKCSQV
CLIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q149M9	1.000	1.000	0.000	1564	1.000	1.000	Q149M9.pdb.gz	NWD1_HUMAN NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3
2	AFDB:O62471	0.539	0.531	8.274E-76	1592	0.169	0.166	O62471.pdb.gz	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
3	AFDB:Q99973	0.560	0.364	1.842E-55	2627	0.177	0.105	Q99973.pdb.gz	TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2
4	AFDB:O08653	0.519	0.331	5.345E-53	2629	0.171	0.102	O08653.pdb.gz	TEP1_RAT Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1
5	AFDB:P97499	0.284	0.177	3.163E-52	2629	0.168	0.100	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
6	AFDB:O88879	0.421	0.509	5.540E-44	1249	0.127	0.159	O88879.pdb.gz	APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus OX=10090 GN=Apaf1 PE=1 SV=3
7	AFDB:O14727	0.383	0.460	1.849E-42	1248	0.117	0.147	O14727.pdb.gz	APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1 PE=1 SV=2
8	AFDB:Q585R2	0.276	0.279	7.943E-38	1537	0.120	0.122	Q585R2.pdb.gz	Q585R2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.130 PE=4 SV=1
9	PDB:3sfzA	0.386	0.504	6.917E-36	1133	0.114	0.157	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
10	PDB:5juyB	0.359	0.432	2.200E-34	1234	0.115	0.146	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
11	AFDB:Q7KLI1	0.267	0.283	6.739E-31	1440	0.121	0.132	Q7KLI1.pdb.gz	Q7KLI1_DROME Apaf-1 related killer DARK OS=Drosophila melanogaster OX=7227 GN=Dark PE=1 SV=1
12	PDB:7mqaLQ	0.238	0.381	1.522E-30	830	0.073	0.137	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q38D82	0.307	0.305	3.453E-30	1578	0.107	0.106	Q38D82.pdb.gz	Q38D82_TRYB2 Flagellar Member 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4280 PE=4 SV=1
14	PDB:7ajuUL	0.226	0.384	5.142E-26	779	0.059	0.118	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7d5sB2	0.229	0.356	3.515E-25	851	0.058	0.106	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:7mq8LT	0.148	0.251	4.469E-25	869	0.059	0.107	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1nr0A	0.217	0.418	4.708E-24	610	0.054	0.138	1nr0A.pdb.gz
18	PDB:7mq8LO	0.179	0.293	7.256E-24	848	0.056	0.104	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7mq8LR	0.140	0.274	9.226E-24	773	0.054	0.109	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6lqsB1	0.216	0.364	1.565E-23	806	0.065	0.125	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W0U9	0.0	3113	1522	0.973	1.000	F8W0U9_HUMAN NACHT and WD repeat domain containing 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=1
2	Q149M9	0.0	3214	1564	1.000	1.000	NWD1_HUMAN NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3
3	O62471	2.02e-36	153	1592	0.166	0.163	QUI1_CAEEL Protein qui-1 OS=Caenorhabditis elegans OX=6239 GN=qui-1 PE=1 SV=2
4	Q8I0F4	3.68e-11	69.7	419	0.058	0.215	LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum OX=44689 GN=lis1 PE=1 SV=1
5	Q3Y8L7	5.24e-11	69.3	446	0.035	0.123	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
6	Q8N136	6.34e-11	68.9	415	0.042	0.157	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
7	A0MNP2	1.63e-10	67.0	357	0.042	0.185	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
8	Q96DI7	1.63e-10	67.0	357	0.042	0.185	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1
9	Q09855	3.60e-10	66.6	506	0.043	0.134	POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof11 PE=1 SV=2
10	Q8JZX3	1.57e-09	64.3	405	0.051	0.195	POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus OX=10090 GN=Poc1a PE=2 SV=2
11	O14170	2.03e-09	64.7	703	0.042	0.094	POP2_SCHPO WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop2 PE=1 SV=1
12	P63004	3.37e-09	63.2	410	0.054	0.205	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
13	P63005	3.37e-09	63.2	410	0.054	0.205	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
14	P43034	3.55e-09	63.2	410	0.054	0.205	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
15	Q9VPR4	3.82e-09	63.5	488	0.054	0.174	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
16	O74855	4.08e-09	63.5	502	0.051	0.157	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
17	Q9D4T2	4.24e-09	62.0	304	0.041	0.211	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
18	P43033	4.95e-09	62.8	410	0.054	0.205	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
19	Q9M2Z2	5.00e-09	62.0	317	0.038	0.186	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
20	Q9V3J8	6.86e-09	62.0	361	0.026	0.114	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	11	17.9	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.0026	29.6	AAA ATPase domain
3	PF13401 AAA_22	0.17	23.6	AAA domain
4	PF07728 AAA_5	4.1e+02	12.4	AAA domain (dynein-related subfamily)
5	PF12894 ANAPC4_WD40	8.5e-06	37.3	Anaphase-promoting complex subunit 4 WD40 domain
6	PF01637 ATPase_2	2.1e+02	13.2	ATPase domain predominantly from Archaea
7	PF13271 DUF4062	57	15.5	Domain of unknown function (DUF4062)
8	PF01695 IstB_IS21	3.9e+02	11.9	IstB-like ATP binding protein
9	PF01078 Mg_chelatase	6e+02	11.2	Magnesium chelatase, subunit ChlI
10	PF05729 NACHT	8e-09	47.1	NACHT domain
11	PF20426 NBCH_WD40	4e-06	37.5	Neurobeachin beta propeller domain
12	PF08801 Nucleoporin_N	0.00035	31.1	Nup133 N terminal like
13	PF11715 Nup160	5.2e+02	10.7	Nucleoporin Nup120/160
14	PF00910 RNA_helicase	7.3e+02	12.0	RNA helicase
15	PF05496 RuvB_N	1.9e+02	13.2	Holliday junction DNA helicase RuvB P-loop domain
16	PF05621 TniB	38	15.2	Bacterial TniB protein
17	PF00400 WD40	7e-14	63.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008964329.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958403.1	0.950	Belongs to the histone H2B family.
2	9597.XP_003804484.2	0.859	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
3	9597.XP_008963004.1	0.855	Bromodomain PHD finger transcription factor
4	9597.XP_003828491.1	0.799	Damage specific DNA binding protein 1
5	9597.XP_003808413.1	0.795	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 212 ESTs, 95 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns
6	9597.XP_008960678.1	0.795	Lysine demethylase 6B
7	9597.XP_003826330.1	0.792	SEC13 homolog, nuclear pore and COPII coat complex component
8	9597.XP_008969390.1	0.792	Belongs to the WD repeat SEC13 family.
9	9597.XP_003815642.1	0.788	Translocated promoter region, nuclear basket protein
10	9597.XP_008974817.1	0.768	RB binding protein 5, histone lysine methyltransferase complex subunit
11	9597.XP_008951610.1	0.740	TATA-box binding protein associated factor 3
12	9597.XP_003818813.1	0.720	WD repeat domain 82
13	9597.XP_003830776.1	0.720	ASH2 like histone lysine methyltransferase complex subunit
14	9597.XP_008965131.1	0.709	Transcriptional adaptor 3
15	9597.XP_003827214.1	0.706	Dpy-30, histone methyltransferase complex regulatory subunit
16	9597.XP_003824269.1	0.700	Myb like, SWIRM and MPN domains 1
17	9597.XP_003829732.2	0.693	Histone H3.1-like
18	9597.XP_003829744.2	0.693	Histone H3.1-like
19	9597.XP_008958120.1	0.693	Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
20	9597.XP_008959404.1	0.693	Belongs to the MHC class I family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0051090	0.974	regulation of DNA-binding transcription factor activity
GO:0044092	0.951	negative regulation of molecular function
GO:0043433	0.924	negative regulation of DNA-binding transcription factor activity
GO:0048518	0.916	positive regulation of biological process
GO:0032088	0.913	negative regulation of NF-kappaB transcription factor activity
GO:0010604	0.853	positive regulation of macromolecule metabolic process
GO:0009987	0.758	cellular process
GO:0008152	0.566	metabolic process
GO:0006807	0.519	nitrogen compound metabolic process
GO:0071704	0.509	organic substance metabolic process
GO:0044238	0.384	primary metabolic process
GO:0010628	0.379	positive regulation of gene expression
GO:0044237	0.334	cellular metabolic process
GO:0048522	0.309	positive regulation of cellular process
GO:0006725	0.306	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	1.000	nuclear lumen
GO:0005829	0.999	cytosol
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.975	nucleolus
GO:0005654	0.952	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]