StarFunc result for job id Q149N8

User Input

>input (1683 residues)
MSSRRKRAPPVRVDEEKRQQLHWNMHEDRRNEPIIISDDDEQPCPGSDTSSAHYIILSDS
LKEEVAHRDKKRCSKVVSFSKPIEKEETVGIFSPLSVKLNIVISPYHFDNSWKAFLGELT
LQLLPAQSLIENFSERSITLMSSESSNQFLIYVHSKGEDVEKQKKEPMSICDKGILVESS
FSGEMLEDLGWLQKKRRIKLYQKPEGNHIIKVGIYLLEAGLAKLDFLSDANSRMKKFNQL
MKKVMEKLHNSIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL
IPVLRPYQREAVNWMLQQECFRSSPATESALHFLWREIVTSEGLKLYYNPYTGCIIREYP
NSGPQLLGGILADEMGLGKTVEVLALILTHTRQDVKQDALTLPEGKVVNYFIPSHYFGGK
LKKTEIQNIEFEPKEKVQCPPTRVMILTAVKEMNGKKGVSILSIYKYVSSIYRYDVQRNR
SLLKRMLKCLIFEGLVKQIKGHGFSGTFTLGKNYKEEDICDKTKKQAVGSPRKIQKETRK
SGNKDTDSEYLPSDTSDDDDDPYYYYYKSRRNRSKLRKKLVPSTKKGKSQPFINPDSQGH
CPATSDSGITDVAMSKSTCISEFNQEHETEDCAESLNHADSDVPPSNTMSPFNTSDYRFE
CICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTRATLI
ISPSSICHQWVDEINRHVRSSSLRVLVYQGVKKDGFLQPHFLAEQDIVIITYDVLRSELN
YVDIPHSNSEDGRRLRNQKRYMAIPSPLVAVEWWRICLDEAQMVECPTVKAAEMAQRLSG
INRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQHLYSFIAKIL
WRSAKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDVVVKLRKISDWALKLS
SLDRRTVTSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCGTECEEAH
RQLVCALNGLAGIHIIKGEYALAAELYREVLRSSEEHKGKLKTDSLQRLHATHNLMELLI
ARHPGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALYPVQQTIHELQRKIHSNSP
WWLNVIHRAIEFTIDEELVQRVRNEITSNYKQQTGKLSMSEKFRDCRGLQFLLTTQMEEL
NKCQKLVREAVKNLEGPPSRNVIESATVCHLRPARLPLNCCVFCKADELFTEYESKLFSN
TVKGQTAIFEEMIEDEEGLVDDRAPTTTRGLWAISETERSMKAILSFAKSHRFDVEFVDE
GSTSMDLFEAWKKEYKLLHEYWMALRNRVSAVDELAMATERLRVRDPREPKPNPPVLHII
EPHEVEQNRIKLLNDKAVATSQLQKKLGQLLYLTNLEKSQDKTSGGVNPEPCPICARQLG
KQWAVLTCGHCFCNECISIIIEQYSVGSHRSSIKCAICRQTTSHKEISYVFTSEKANQEE
DIPVKGSHSTKVEAVVRTLMKIQLRDPGAKALVFSTWQDVLDIISKALTDNNMEFAQISR
VKTFQENLSAFKRDPQINILLLPLHTGSNGLTIIEATHVLLVEPILNPAHELQAIGRVHR
IGQTKPTIVHRFLIKATIEERMQAMLKTAERSHTNSSAKHSEASVLTVADLADLFTKETE
ELE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q149N8	1.000	1.000	0.000	1683	1.000	1.000	Q149N8.pdb.gz	SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens OX=9606 GN=SHPRH PE=1 SV=2
2	PDB:7r78A	0.257	0.232	3.405E-18	1880	0.086	0.077	7r78A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
3	AFDB:O14148	0.220	0.230	7.016E-18	1604	0.145	0.152	O14148.pdb.gz	INO80_SCHPO Chromatin-remodeling ATPase INO80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ino80 PE=1 SV=4
4	PDB:6gejM	0.201	0.461	2.966E-17	688	0.080	0.196	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
5	PDB:7r76A	0.210	0.196	9.820E-17	1834	0.094	0.087	7r76A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
6	PDB:7t02A	0.205	0.198	1.706E-15	1752	0.086	0.083	7t02A.pdb.gz	Structural insights into DNMT5-mediated ATP-dependent high-fidelity epigenome maintenance.
7	AFDB:B0R0I6	0.206	0.141	3.855E-13	2511	0.117	0.078	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
8	AFDB:F4IV99	0.198	0.193	1.276E-12	1724	0.106	0.104	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
9	PDB:6jylK	0.188	0.589	9.374E-10	504	0.062	0.208	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
10	PDB:7oo3b	0.207	0.591	1.127E-9	534	0.062	0.195	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
11	PDB:7epuB	0.094	0.201	9.374E-9	748	0.030	0.067	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
12	PDB:6g0lM	0.173	0.331	4.486E-8	855	0.054	0.106	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:6g0lW	0.110	0.199	4.919E-8	878	0.059	0.113	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:5vvrM	0.078	0.251	2.582E-7	503	0.022	0.074	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
15	AFDB:P02255	0.053	0.302	5.319E-6	256	0.027	0.180	P02255.pdb.gz	H1_DROME Histone H1 OS=Drosophila melanogaster OX=7227 GN=His1 PE=1 SV=1
16	AFDB:Q02539	0.045	0.331	3.514E-5	215	0.031	0.247	Q02539.pdb.gz	H11_HUMAN Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3
17	AFDB:P43275	0.046	0.342	9.678E-5	213	0.030	0.235	P43275.pdb.gz	H11_MOUSE Histone H1.1 OS=Mus musculus OX=10090 GN=H1-1 PE=1 SV=2
18	AFDB:Q5XJ47	0.048	0.269	2.022E-4	270	0.027	0.167	Q5XJ47.pdb.gz
19	AFDB:Q8VIK3	0.049	0.245	2.322E-4	304	0.031	0.171	Q8VIK3.pdb.gz	H18_MOUSE Histone H1.8 OS=Mus musculus OX=10090 GN=H1.8 PE=2 SV=1
20	AFDB:P07305	0.045	0.367	5.079E-4	194	0.026	0.227	P07305.pdb.gz	H10_HUMAN Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q149N8	0.0	3502	1683	1.000	1.000	SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens OX=9606 GN=SHPRH PE=1 SV=2
2	Q9UTL9	2.47e-34	146	1375	0.063	0.077	YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC144.05 PE=3 SV=1
3	F4HTG1	3.72e-29	129	1280	0.052	0.069	F4HTG1_ARATH SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=EDA16 PE=1 SV=1
4	Q9FNI6	7.33e-29	128	1029	0.049	0.080	SM3L2_ARATH DNA repair protein RAD5A OS=Arabidopsis thaliana OX=3702 GN=RAD5A PE=1 SV=1
5	Q9FIY7	2.30e-28	127	1277	0.056	0.074	SM3L3_ARATH DNA repair protein RAD5B OS=Arabidopsis thaliana OX=3702 GN=RAD5B PE=3 SV=1
6	Q10332	1.96e-27	123	830	0.053	0.108	YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC582.10c PE=1 SV=1
7	Q6PCN7	1.44e-26	120	1003	0.048	0.081	HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus OX=10090 GN=Hltf PE=1 SV=1
8	P36607	2.51e-26	120	1133	0.050	0.074	RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad8 PE=1 SV=1
9	Q95216	2.29e-25	117	1005	0.048	0.081	HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus OX=9986 GN=HLTF PE=1 SV=1
10	A0A0C4DGA6	2.46e-25	117	1008	0.048	0.080	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
11	Q14527	2.51e-25	117	1009	0.048	0.080	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
12	Q9UNY4	3.14e-25	117	1162	0.059	0.086	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
13	O13762	5.03e-25	115	897	0.064	0.119	YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17A2.12 PE=3 SV=1
14	Q94BR5	5.15e-25	115	981	0.053	0.091	CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana OX=3702 GN=CHR28 PE=1 SV=1
15	Q9LHE4	2.52e-23	110	1047	0.056	0.090	CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana OX=3702 GN=CHR27 PE=1 SV=1
16	P32849	9.76e-22	105	1169	0.047	0.068	RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD5 PE=1 SV=1
17	Q06554	2.31e-21	104	1556	0.048	0.052	IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC20 PE=1 SV=1
18	Q08562	9.05e-21	102	1619	0.048	0.050	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
19	O60177	8.07e-20	99.0	1040	0.053	0.086	YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC23E6.02 PE=3 SV=1
20	P31244	4.61e-18	93.2	790	0.040	0.086	RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00271 Helicase_C	0.00014	33.5	Helicase conserved C-terminal domain
2	PF00538 Linker_histone	7.9e-15	66.3	linker histone H1 and H5 family
3	PF00628 PHD	0.0096	27.1	PHD-finger
4	PF00176 SNF2-rel_dom	8.7e-113	388.0	SNF2-related domain
5	PF13424 TPR_12	8.3e+02	11.7	Tetratricopeptide repeat
6	PF00097 zf-C3HC4	1.4	20.1	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	3.4	18.9	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.65	21.2	Zinc finger, C3HC4 type (RING finger)
9	PF13639 zf-RING_2	1.2	20.8	Ring finger domain
10	PF14634 zf-RING_5	3.6	19.0	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	0.17	23.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264926	0.995	E3 ubiquitin-protein ligase RAD18
2	9606.ENSP00000316176	0.966	Ubiquitin-conjugating enzyme E2 N
3	9606.ENSP00000428209	0.964	Ubiquitin-conjugating enzyme E2 variant 2
4	9606.ENSP00000368458	0.903	Proliferating cell nuclear antigen
5	9606.ENSP00000307208	0.875	Nucleosome-remodeling factor subunit BPTF
6	9606.ENSP00000265339	0.870	Ubiquitin-conjugating enzyme E2 B
7	9606.ENSP00000371393	0.826	Phosphoglucomutase-2
8	9606.ENSP00000267430	0.804	Fanconi anemia group M protein
9	9606.ENSP00000351697	0.793	DNA polymerase zeta catalytic subunit
10	9606.ENSP00000343526	0.787	Ubiquitin carboxyl-terminal hydrolase 1
11	9606.ENSP00000258428	0.775	DNA repair protein REV1
12	9606.ENSP00000308944	0.764	Helicase-like transcription factor
13	9606.ENSP00000265773	0.744	Probable global transcription activator SNF2L2
14	9606.ENSP00000305974	0.726	Solute carrier organic anion transporter family member 1A2
15	9606.ENSP00000343633	0.721	Forkhead box protein N2
16	9606.ENSP00000369424	0.721	Histone-binding protein RBBP7
17	9606.ENSP00000351284	0.720	DNA repair protein RAD52 homolog
18	9606.ENSP00000476960	0.706	Histone cluster 2 H3 pseudogene 2
19	9606.ENSP00000360613	0.694	Ubiquitin-conjugating enzyme E2 A
20	9606.ENSP00000395654	0.694	Transcription activator BRG1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:1901363	0.847	heterocyclic compound binding
GO:0097159	0.847	organic cyclic compound binding
GO:0003676	0.834	nucleic acid binding
GO:0003677	0.773	DNA binding
GO:0140030	0.364	modification-dependent protein binding
GO:0042393	0.318	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0009987	0.987	cellular process
GO:0000209	0.985	protein polyubiquitination
GO:0006974	0.978	cellular response to DNA damage stimulus
GO:0050789	0.638	regulation of biological process
GO:0044237	0.572	cellular metabolic process
GO:0050794	0.416	regulation of cellular process
GO:0019222	0.405	regulation of metabolic process
GO:0060255	0.390	regulation of macromolecule metabolic process
GO:0034641	0.373	cellular nitrogen compound metabolic process
GO:0016043	0.361	cellular component organization
GO:0044260	0.356	cellular macromolecule metabolic process
GO:0046483	0.330	heterocycle metabolic process
GO:0006725	0.330	cellular aromatic compound metabolic process
GO:1901360	0.326	organic cyclic compound metabolic process
GO:0006139	0.316	nucleobase-containing compound metabolic process
GO:0080090	0.303	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.928	protein-containing complex
GO:0043228	0.922	non-membrane-bounded organelle
GO:0043232	0.913	intracellular non-membrane-bounded organelle
GO:0005737	0.536	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]