StarFunc result for job id Q14BN4

User Input

>input (828 residues)
MPSALAIFTCRPNSHPFQERHVYLDEPIKIGRSVARCRPAQNNATFDCKVLSRNHALVWF
DHKTGKFYLQDTKSSNGTFINSQRLSRGSEESPPCEILSGDIIQFGVDVTENTRKVTHGC
IVSTIKLFLPDGMEARLRSDVIHAPLPSPVDKVAANTPSMYSQELFQLSQYLQEALHREQ
MLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQACSKNQTEDSLRKEL
IALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEEL
RELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKI
EALQADNDFTNERLTALQVRLEHLQEKTLKECSSLEHLLSKSGGDCTFIHQFIECQKKLI
VEGHLTKAVEETKLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLNEPLAKVS
LLKDDLQGAQSEIEAKQEIQHLRKELIEAQELARTSKQKCFELQALLEEERKAYRNQVEE
STKQIQVLQAQLQRLHIDTENLREEKDSEITSTRDELLSARDEILLLHQAAAKVASERDT
DIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELE
KLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELEN
QVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITD
ELKQCKNNLKLLREKGNNKPWPWMPMLAALVAVTAIVLYVPGLARASP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3URD3	0.428	0.421	4.747E-88	845	0.944	0.925	Q3URD3.pdb.gz	SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus OX=10090 GN=Slmap PE=1 SV=2
2	AFDB:Q9VB25	0.111	0.075	3.115E-6	1265	0.094	0.062	Q9VB25.pdb.gz	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
3	PDB:7dvqX	0.101	0.446	4.632E-5	156	0.028	0.147	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
4	PDB:2ff4A	0.093	0.196	4.453E-4	379	0.030	0.066	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
5	PDB:5gm6U	0.114	0.451	5.868E-4	176	0.024	0.114	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
6	PDB:5z56X	0.098	0.446	1.271E-3	159	0.024	0.126	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
7	PDB:2kb3A	0.096	0.462	3.074E-3	143	0.035	0.203	2kb3A.pdb.gz
8	PDB:6l9wD	0.087	0.408	2.369E-2	142	0.018	0.106	6l9wD.pdb.gz
9	AFDB:Q9Y2F5	0.080	0.032	3.370E-1	2266	0.065	0.024	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
10	PDB:6xt9A	0.054	0.073	3.743E-1	567	0.033	0.048	6xt9A.pdb.gz
11	AFDB:P53253	0.142	0.130	4.441E-1	936	0.079	0.069	P53253.pdb.gz	NNF2_YEAST Protein NNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NNF2 PE=1 SV=1
12	PDB:1mm4A	0.048	0.167	5.508E-1	170	0.018	0.088	1mm4A.pdb.gz
13	AFDB:Q06704	0.234	0.214	6.184E-1	911	0.149	0.135	Q06704.pdb.gz	IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IMH1 PE=1 SV=1
14	PDB:4h2aA	0.084	0.096	7.671E-1	704	0.022	0.026	4h2aA.pdb.gz	Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
15	AFDB:Q383W4	0.100	0.166	7.712E-1	484	0.063	0.107	Q383W4.pdb.gz	Q383W4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1410 PE=4 SV=1
16	AFDB:Q386P9	0.102	0.176	8.150E-1	461	0.062	0.111	Q386P9.pdb.gz	Q386P9_TRYB2 DUF4201 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0210 PE=4 SV=1
17	PDB:4c9iF	0.041	0.126	8.567E-1	162	0.014	0.074	4c9iF.pdb.gz	The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
18	AFDB:P02566	0.111	0.056	1.016	1963	0.175	0.074	P02566.pdb.gz	MYO4_CAEEL Myosin-4 OS=Caenorhabditis elegans OX=6239 GN=unc-54 PE=1 SV=2
19	AFDB:Q91785	0.141	0.090	1.016	1388	0.169	0.101	Q91785.pdb.gz	KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis OX=8355 GN=kif15-a PE=1 SV=1
20	AFDB:Q8N6L0	0.073	0.106	1.074	562	0.080	0.117	Q8N6L0.pdb.gz	KASH5_HUMAN Protein KASH5 OS=Homo sapiens OX=9606 GN=KASH5 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z964	0.0	713	362	0.437	1.000	B7Z964_HUMAN cDNA FLJ60222, highly similar to Homo sapiens sarcolemma associated protein (SLMAP), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
2	Q14BN4	0.0	1678	828	1.000	1.000	SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1
3	Q3URD3	0.0	1565	845	0.946	0.927	SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus OX=10090 GN=Slmap PE=1 SV=2
4	Q9W5R5	9.41e-65	235	897	0.145	0.134	Q9W5R5_DROME LD47843p OS=Drosophila melanogaster OX=7227 GN=Slmap PE=1 SV=2
5	Q9Y228	1.29e-27	120	551	0.087	0.131	T3JAM_HUMAN TRAF3-interacting JNK-activating modulator OS=Homo sapiens OX=9606 GN=TRAF3IP3 PE=1 SV=2
6	Q8C0G2	3.25e-24	109	513	0.082	0.133	T3JAM_MOUSE TRAF3-interacting JNK-activating modulator OS=Mus musculus OX=10090 GN=Traf3ip3 PE=1 SV=2
7	Q3TVA9	8.34e-20	97.4	1136	0.088	0.064	CC136_MOUSE Coiled-coil domain-containing protein 136 OS=Mus musculus OX=10090 GN=Ccdc136 PE=1 SV=2
8	O74388	9.83e-20	92.8	301	0.058	0.159	YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3H7.13 PE=1 SV=1
9	Q96JN2	1.27e-17	90.5	1154	0.122	0.088	CC136_HUMAN Coiled-coil domain-containing protein 136 OS=Homo sapiens OX=9606 GN=CCDC136 PE=1 SV=3
10	E7FCY3	5.05e-17	85.9	358	0.087	0.201	E7FCY3_DANRE Coiled-coil domain-containing 136b OS=Danio rerio OX=7955 GN=ccdc136b PE=4 SV=1
11	Q06001	9.64e-14	77.0	478	0.063	0.109	FAR10_YEAST Factor arrest protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAR10 PE=1 SV=1
12	Q10322	5.50e-10	63.2	267	0.047	0.146	DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dma1 PE=1 SV=1
13	P53924	1.31e-08	60.8	522	0.047	0.075	DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMA2 PE=1 SV=1
14	P38823	1.60e-08	60.1	416	0.050	0.099	DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMA1 PE=1 SV=1
15	P19137	2.88e-07	57.0	3083	0.134	0.036	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
16	Q2Q1W5	1.87e-05	51.2	3664	0.121	0.027	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
17	E7EY31	0.10	38.9	1022	0.060	0.049	E7EY31_DANRE Coiled-coil domain-containing 57 OS=Danio rerio OX=7955 GN=ccdc57 PE=4 SV=1
18	P12270	0.17	38.1	2363	0.083	0.029	TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3
19	Q3UU96	0.19	37.7	1719	0.107	0.052	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2
20	Q8I3S3	0.51	36.6	1894	0.059	0.026	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	8.7e-14	62.9	FHA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000028673

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000026959	0.974	Striatin interacting protein 1
2	9593.ENSGGOP00000015262	0.972	Suppressor of IKBKE 1
3	9593.ENSGGOP00000026580	0.971	Striatin, calmodulin binding protein
4	9593.ENSGGOP00000013013	0.962	Serine/threonine kinase 26
5	9593.ENSGGOP00000027025	0.959	Programmed cell death 10
6	9593.ENSGGOP00000006514	0.955	Protein phosphatase 2, regulatory subunit A, alpha
7	9593.ENSGGOP00000001952	0.954	Serine/threonine kinase 24
8	9593.ENSGGOP00000004187	0.954	Serine/threonine kinase 25
9	9593.ENSGGOP00000005973	0.954	Striatin, calmodulin binding protein 3
10	9593.ENSGGOP00000008805	0.942	MOB family member 4, phocein
11	9593.ENSGGOP00000016405	0.920	Striatin interacting protein 2
12	9593.ENSGGOP00000000333	0.897	Protein phosphatase 2, catalytic subunit, alpha isozyme
13	9593.ENSGGOP00000013634	0.897	Protein phosphatase 2, catalytic subunit, beta isozyme
14	9593.ENSGGOP00000013604	0.882	Uncharacterized protein
15	9593.ENSGGOP00000026523	0.882	FGFR1 oncogene partner 2
16	9593.ENSGGOP00000010015	0.877	Protein phosphatase 2, regulatory subunit A, beta
17	9593.ENSGGOP00000009927	0.846	Striatin, calmodulin binding protein 4
18	9593.ENSGGOP00000002557	0.764	Tumor protein p53 binding protein 1
19	9593.ENSGGOP00000000718	0.760	Mediator of DNA-damage checkpoint 1
20	9593.ENSGGOP00000024776	0.760	PAX interacting (with transcription-activation domain) protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.995	cellular process
GO:0065009	0.993	regulation of molecular function
GO:0050794	0.991	regulation of cellular process
GO:0032879	0.986	regulation of localization
GO:0032409	0.983	regulation of transporter activity
GO:0034762	0.982	regulation of transmembrane transport
GO:0010959	0.982	regulation of metal ion transport
GO:1904062	0.973	regulation of monoatomic cation transmembrane transport
GO:0051179	0.969	localization
GO:0032412	0.968	regulation of monoatomic ion transmembrane transporter activity
GO:0002028	0.957	regulation of sodium ion transport
GO:1902305	0.938	regulation of sodium ion transmembrane transport
GO:0051641	0.928	cellular localization
GO:0072657	0.924	protein localization to membrane
GO:2000649	0.913	regulation of sodium ion transmembrane transporter activity
GO:1990778	0.908	protein localization to cell periphery
GO:0065008	0.885	regulation of biological quality
GO:0042391	0.839	regulation of membrane potential
GO:2001257	0.815	regulation of cation channel activity
GO:0032501	0.759	multicellular organismal process
GO:0003254	0.731	regulation of membrane depolarization
GO:0003012	0.614	muscle system process
GO:0006936	0.601	muscle contraction
GO:0072659	0.522	protein localization to plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005886	0.993	plasma membrane
GO:0005829	0.929	cytosol
GO:0005783	0.450	endoplasmic reticulum
GO:0070013	0.418	intracellular organelle lumen
GO:0031981	0.403	nuclear lumen
GO:0005654	0.387	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]