StarFunc result for job id Q14C86

User Input

>input (1478 residues)
MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLII
TSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKL
NQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSI
LFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGS
DRFRQKVQEMVESNEAKLVALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVG
EVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGD
PRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNF
MKSVMSGDQLREDRMALDNLLANLPPAKPGKSSSLEMTPYNTPQLSPATTPANKKNRLPI
ATRSRSRTNMLMDLHMDHEGSSQETIQEVQPEEVLVISLGTGPQLTPGMMSENEVLNMQL
SDGGQGDVPVDENKLHGKPDKTLRFSLCSDNLEGISEGPSNRSNSVSSLDLEGESVSELG
AGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVL
GSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLLDPCTGSTISETTSEAWSVEVL
PSDSEAPDLKQEERLQELESCSGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPN
KIEDLRSECSSDFGGKDSVTSPDMDEITHGAHQLTSPPSQSESLLAMFDPLSSHEGASAV
VRPKVHYARPSHPPPDPPILEGAVGGNEARLPNFGSHVLTPAEMEAFKQRHSYPERLVRS
RSSDIVSSVRRPMSDPSWNRRPGNEERELPPAAAIGATSLVAAPHSSSSSPSKDSSRGET
EERKDSDDEKSDRNRPWWRKRFVSAMPKAPIPFRKKEKQEKDKDDLGPDRFSTLTDDPSP
RLSAQAQVAEDILDKYRNAIKRTSPSDGAMANYESTGDNHDRDLSSKLLYHSDKEVMGDG
ESAHDSPRDEALQNISADDLPDSASQAAHPQDSAFSYRDAKKKLRLALCSADSVAFPVLT
HSTRNGLPDHTDPEDNEIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRFDNRTCRKLL
ASIAEDYRKRAPYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLES
KEKKIREFIQDFQKLTAADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERS
VMNRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSE
IRTISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLS
TVQYISSFYASCLSGEESYWWMQFTAAVEFIKTIDDRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14C86	1.000	1.000	0.000	1478	1.000	1.000	Q14C86.pdb.gz	GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2
2	AFDB:Q6PAR5	0.692	0.700	0.000	1458	0.966	0.979	Q6PAR5.pdb.gz	GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gapvd1 PE=1 SV=2
3	PDB:7r04A	0.173	0.114	1.226E-4	2326	0.052	0.033	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
4	PDB:7mp5A	0.115	0.105	9.111E-4	1629	0.045	0.041	7mp5A.pdb.gz
5	PDB:7r04B	0.143	0.097	2.095E-3	2229	0.039	0.026	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
6	AFDB:Q5UIP0	0.046	0.033	1.685E-2	2472	0.095	0.057	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:Q21227	0.056	0.064	8.908E-2	1188	0.114	0.141	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
8	AFDB:A0A1D8PD52	0.046	0.051	1.301E-1	1287	0.114	0.131	A0A1D8PD52.pdb.gz	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1
9	AFDB:G5ECF0	0.140	0.112	1.457E-1	1890	0.094	0.074	G5ECF0.pdb.gz	G5ECF0_CAEEL SH2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rin-1 PE=1 SV=1
10	AFDB:Q9VWE6	0.052	0.038	1.571E-1	2111	0.115	0.081	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
11	PDB:7c76B	0.058	0.113	2.761E-1	483	0.040	0.122	7c76B.pdb.gz
12	PDB:4hm9A	0.061	0.110	3.336E-1	511	0.027	0.078	4hm9A.pdb.gz
13	PDB:6v9iC	0.059	0.104	3.336E-1	730	0.045	0.092	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
14	PDB:7cunG	0.048	0.067	3.336E-1	895	0.041	0.068	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
15	AFDB:Q7Z6I6	0.036	0.044	3.350E-1	1101	0.095	0.127	Q7Z6I6.pdb.gz	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
16	AFDB:Q5I012	0.049	0.058	3.752E-1	1090	0.118	0.161	Q5I012.pdb.gz	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
17	PDB:3msvA	0.061	0.150	4.348E-1	352	0.030	0.128	3msvA.pdb.gz
18	PDB:7nyhN	0.050	0.110	4.348E-1	467	0.037	0.118	7nyhN.pdb.gz
19	PDB:7t6bR	0.039	0.155	4.516E-1	264	0.029	0.163	7t6bR.pdb.gz	Structure of S1PR2-heterotrimeric G 13 signaling complex.
20	AFDB:P21339	0.048	0.052	4.709E-1	1137	0.095	0.123	P21339.pdb.gz	MSB1_YEAST Morphogenesis-related protein MSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSB1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0QZ65	0.0	999	497	0.327	0.972	B0QZ65_HUMAN GTPase activating protein and VPS9 domains 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
2	C9IZ08	0.0	2035	988	0.668	1.000	C9IZ08_HUMAN GTPase activating protein and VPS9 domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
3	F8W9S7	0.0	2885	1412	0.955	1.000	F8W9S7_HUMAN GTPase activating protein and VPS9 domains 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
4	H0Y4E7	0.0	1623	830	0.543	0.966	H0Y4E7_HUMAN GTPase activating protein and VPS9 domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
5	H0Y7I9	0.0	1705	837	0.566	0.999	H0Y7I9_HUMAN GTPase activating protein and VPS9 domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=1
6	Q14C86	0.0	3056	1478	1.000	1.000	GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2
7	Q6PAR5	0.0	2949	1458	0.966	0.979	GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gapvd1 PE=1 SV=2
8	Q9GYH7	2.21e-51	201	1093	0.075	0.102	RME6_CAEEL Receptor-mediated endocytosis protein 6 OS=Caenorhabditis elegans OX=6239 GN=rme-6 PE=1 SV=2
9	Q9LT31	2.99e-32	135	520	0.052	0.148	VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana OX=3702 GN=VPS9A PE=1 SV=1
10	Q10NQ3	3.69e-30	128	480	0.053	0.165	VPS9A_ORYSJ Vacuolar protein sorting-associated protein 9A OS=Oryza sativa subsp. japonica OX=39947 GN=VPS9A PE=1 SV=1
11	Q9JM13	5.85e-18	91.3	491	0.034	0.102	RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus OX=10090 GN=Rabgef1 PE=1 SV=1
12	O18973	3.97e-17	88.6	492	0.042	0.126	RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus OX=9913 GN=RABGEF1 PE=1 SV=1
13	Q9UJ41	6.25e-17	88.2	491	0.032	0.098	RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=3
14	E9PFK9	7.37e-17	87.8	504	0.033	0.097	E9PFK9_HUMAN RAB guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RABGEF1 PE=1 SV=1
15	Q9W0H9	1.16e-16	88.2	696	0.042	0.089	Q9W0H9_DROME Rabaptin-5-associated exchange factor for Rab5 OS=Drosophila melanogaster OX=7227 GN=Rabex-5 PE=1 SV=1
16	Q55AA6	3.06e-14	80.5	715	0.034	0.070	Q55AA6_DICDI Vacuolar sorting protein 9 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272038 PE=4 SV=1
17	P54787	3.41e-14	79.3	451	0.039	0.126	VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS9 PE=1 SV=2
18	Q8I100	1.48e-12	74.3	517	0.033	0.095	Q8I100_CAEEL Rab5 GDP/GTP exchange factor OS=Caenorhabditis elegans OX=6239 GN=rabx-5 PE=1 SV=2
19	Q54I64	1.48e-09	65.1	817	0.044	0.080	Q54I64_DICDI RasGTPase-activating protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288977 PE=4 SV=1
20	Q54K32	3.49e-08	60.8	822	0.047	0.085	RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum OX=44689 GN=rgaA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18151 DUF5601	9.3e-13	59.5	Domain of unknown function (DUF5601)
2	PF19011 DUF5740	1.5e+02	14.1	Family of unknown function (DUF5740)
3	PF00616 RasGAP	1.9e-31	121.0	GTPase-activator protein for Ras-like GTPase
4	PF02204 VPS9	3e-25	99.8	Vacuolar sorting protein 9 (VPS9) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000461945	0.975	Ras-related protein Rab-31
2	9606.ENSP00000369538	0.930	Rab GDP dissociation inhibitor beta
3	9606.ENSP00000273047	0.928	Ras-related protein Rab-5A
4	9606.ENSP00000394071	0.924	Rab GDP dissociation inhibitor alpha
5	9606.ENSP00000355511	0.917	Rab proteins geranylgeranyltransferase component A 2
6	9606.ENSP00000350386	0.912	Rab proteins geranylgeranyltransferase component A 1
7	9606.ENSP00000445408	0.886	Rab GTPase-binding effector protein 1
8	9606.ENSP00000320117	0.884	Cdc42-interacting protein 4
9	9606.ENSP00000353444	0.852	Ras-related protein Rab-5B
10	9606.ENSP00000238738	0.834	Rho-related GTP-binding protein RhoQ
11	9606.ENSP00000447053	0.818	Ras-related protein Rab-5C
12	9606.ENSP00000264276	0.815	Alsin
13	9606.ENSP00000264601	0.740	Ras-related protein Rab-17
14	9606.ENSP00000380044	0.740	Casein kinase I isoform epsilon
15	9606.ENSP00000342604	0.728	Protein FAM184A
16	9606.ENSP00000261369	0.724	Sorting nexin-24
17	9606.ENSP00000248248	0.718	MON1 homolog B, secretory trafficking associated
18	9606.ENSP00000310406	0.712	Ras and Rab interactor 1
19	9606.ENSP00000317955	0.710	Early endosome antigen 1
20	9606.ENSP00000296473	0.708	Vacuolar fusion protein MON1 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032794	1.000	GTPase activating protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0045296	0.931	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060341	0.960	regulation of cellular localization
GO:0032880	0.940	regulation of protein localization
GO:0051223	0.915	regulation of protein transport
GO:0009987	0.702	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005829	0.998	cytosol
GO:0012505	0.480	endomembrane system
GO:0043231	0.445	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]