StarFunc result for job id Q14C87

User Input

>input (1099 residues)
MCPSEMGTLWHHWSPVLISLAALFSKVTEGRGILESIQRFSLLPTYLPVTYHINNADVSF
FLKEANQDIMRNSSLQSRVESFLIYKSRRLPVLNASYGPFSIEQVVPQDLMLPSNPFGFT
NKFSLNWKLKAHILRDKVYLSRPKVQVLFHIMGRDWDDRSAGEKLPCLRVFAFRETREVR
GSCRLQGDLGLCVAELELLSSWFSPPTVVAGRRKSVDQPEGTPVELYYTVHPGGERGDCV
REDARRSNGIRTGHSDIDESGPPLQRIGSIFLYQTHRKPSLRELRLDNSVAIHYIPKTVR
KGDVLTFPVSISRNSTEDRFTLRAKVKKGVNIIGVRASSPSIWDVKERTDYTGKYAPAVI
VCQKKAAGSENSADGASYEVMQIDVEVEEPGDLPATQLVTWQVEYPGEITSDLGVSKIYV
SPKDLIGVVPLAMEAEILNTAILTGKTVAVPVKVVSVEDDGTVTELLESVECRSSDEDVI
KVSDRCDYVFVNGKEMKGKVNVVVNFTYQHLSSPLEMTVWVPRLPLQIEVSDTELNQIKG
WRVPIVSSRRPAGDSEEEEDDERRGRGCTLQYQHAMVRVLTQFVAEAAGPGGHLAHLLGS
DWQVDITELINDFMQVEEPRIAKLQGGQILMGQELGMTTIQILSPLSDTILAEKTITVLD
EKVTITDLGVQLVTGLSLSLQLSPGSNRAIFATAVAQELLQRPKQEAAISCWVQFSDGSV
TPLDIYDGKDFSLMATSLDEKVVSIHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQKS
KRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGAGVHMENNVSDRRPKKPSQEWGSQEGQ
YYGSSSMGLMEGRGTTTDRSILQKKKGQESLLDDNSHLQTIPSDLTSFPAQVDLPRSNGE
MDGNDLMQASKGLSDLEIGMYALLGVFCLAILVFLINCVTFALKYRHKQVPFEEQEGMSH
SHDWVGLSNRTELLENHINFASSQDEQITAIDRGMDFEESKYLLSTNSQKSINGQLFKPL
GPIIIDGKDQKSEPPTSPTSKRKRVKFTTFTAVSSDDEYPTRNSIVMSSEDDIKWVCQDL
DPGDCKELHNYMERLHENV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14C87	1.000	1.000	0.000	1099	1.000	1.000	Q14C87.pdb.gz	T132D_HUMAN Transmembrane protein 132D OS=Homo sapiens OX=9606 GN=TMEM132D PE=1 SV=1
2	AFDB:Q76HP2	0.836	0.837	0.000	1097	0.824	0.826	Q76HP2.pdb.gz	T132D_RAT Transmembrane protein 132D OS=Rattus norvegicus OX=10116 GN=Tmem132d PE=2 SV=1
3	AFDB:Q9VQW7	0.072	0.060	7.076E-13	1332	0.113	0.093	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
4	AFDB:P13595	0.084	0.083	7.795E-13	1115	0.094	0.092	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
5	AFDB:F7BJK1	0.094	0.095	1.534E-12	1077	0.127	0.130	F7BJK1.pdb.gz	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1
6	AFDB:Q9BZA7	0.075	0.064	5.142E-12	1347	0.110	0.090	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
7	AFDB:B2RY69	0.097	0.089	1.289E-11	1237	0.103	0.091	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
8	AFDB:Q99PJ1	0.078	0.048	1.808E-11	1943	0.124	0.070	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
9	AFDB:A0A2R8RMH2	0.088	0.085	2.933E-11	1150	0.128	0.123	A0A2R8RMH2.pdb.gz
10	AFDB:Q0KIB0	0.088	0.066	9.830E-11	1689	0.092	0.060	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
11	PDB:4aq1A	0.084	0.119	2.998E-10	721	0.085	0.129	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:7sqcO0	0.090	0.088	4.008E-10	1140	0.071	0.068	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:7q1yA	0.106	0.090	3.367E-9	1374	0.072	0.057	7q1yA.pdb.gz
14	PDB:5a42A	0.104	0.080	5.462E-9	1597	0.082	0.056	5a42A.pdb.gz
15	PDB:4ziqA	0.102	0.083	2.969E-8	1450	0.084	0.063	4ziqA.pdb.gz
16	PDB:3fcsA	0.101	0.118	6.757E-8	913	0.069	0.083	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
17	PDB:7q5zA	0.094	0.079	1.044E-7	1344	0.075	0.061	7q5zA.pdb.gz
18	PDB:4g1eA	0.097	0.109	1.465E-7	964	0.063	0.072	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
19	PDB:4lnvA	0.098	0.087	1.866E-7	1276	0.075	0.064	4lnvA.pdb.gz
20	PDB:7nxdA	0.101	0.121	1.959E-7	905	0.045	0.054	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	L7VG99	0.0	765	1073	0.403	0.413	T132E_DANRE Transmembrane protein 132E OS=Danio rerio OX=7955 GN=tmem132e PE=2 SV=1
2	Q14C87	0.0	2271	1099	1.000	1.000	T132D_HUMAN Transmembrane protein 132D OS=Homo sapiens OX=9606 GN=TMEM132D PE=1 SV=1
3	Q6IEE6	0.0	600	1074	0.304	0.311	T132E_MOUSE Transmembrane protein 132E OS=Mus musculus OX=10090 GN=Tmem132e PE=1 SV=2
4	Q6IEE7	0.0	713	1074	0.392	0.401	T132E_HUMAN Transmembrane protein 132E OS=Homo sapiens OX=9606 GN=TMEM132E PE=1 SV=2
5	Q76HP2	0.0	1870	1097	0.833	0.834	T132D_RAT Transmembrane protein 132D OS=Rattus norvegicus OX=10116 GN=Tmem132d PE=2 SV=1
6	Q24JP5	2.54e-139	448	1023	0.247	0.266	T132A_HUMAN Transmembrane protein 132A OS=Homo sapiens OX=9606 GN=TMEM132A PE=1 SV=1
7	Q922P8	2.67e-139	448	1018	0.253	0.273	T132A_MOUSE Transmembrane protein 132A OS=Mus musculus OX=10090 GN=Tmem132a PE=1 SV=2
8	Q80WF4	3.65e-133	432	1021	0.248	0.267	T132A_RAT Transmembrane protein 132A OS=Rattus norvegicus OX=10116 GN=Tmem132a PE=1 SV=1
9	Q60805	0.37	37.4	994	0.032	0.035	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
10	Q94545	1.7	35.0	556	0.016	0.032	ASH2_DROME Set1/Ash2 histone methyltransferase complex subunit ASH2 OS=Drosophila melanogaster OX=7227 GN=ash2 PE=1 SV=2
11	D3Z9Z3	8.6	33.1	2315	0.030	0.014	D3Z9Z3_RAT SPG11 vesicle trafficking associated, spatacsin OS=Rattus norvegicus OX=10116 GN=Spg11 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16070 TMEM132	7.2e-144	491.0	Transmembrane protein family 132
2	PF15706 TMEM132D_C	8.3e-32	120.2	Mature oligodendrocyte transmembrane protein, TMEM132D, C-term
3	PF15705 TMEM132D_N	2.7e-56	200.5	Mature oligodendrocyte transmembrane protein, TMEM132D, N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378710	0.672	Protein FAM135B
2	9606.ENSP00000281703	0.653	Glycosyltransferase 1 domain-containing protein 1
3	9606.ENSP00000266771	0.650	Solute carrier family 15 member 4
4	9606.ENSP00000354163	0.643	Protein FAM110A
5	9606.ENSP00000357631	0.627	Transcription elongation regulator 1 like
6	9606.ENSP00000259154	0.610	BTB/POZ domain-containing protein KCTD3
7	9606.ENSP00000326249	0.609	Zinc finger protein 454
8	9606.ENSP00000234195	0.604	Regulator of microtubule dynamics 2
9	9606.ENSP00000273920	0.587	Enolase-phosphatase E1
10	9606.ENSP00000305011	0.576	Olfactory receptor 4K14
11	9606.ENSP00000383933	0.572	Protein FAM19A5
12	9606.ENSP00000363257	0.569	Palmitoyltransferase ZDHHC18
13	9606.ENSP00000332110	0.547	Olfactory receptor 4N5
14	9606.ENSP00000416951	0.545	Zinc finger CCCH-type containing 18
15	9606.ENSP00000354227	0.541	Type 2 DNA topoisomerase 6 subunit B-like
16	9606.ENSP00000319305	0.518	Zinc finger protein 572
17	9606.ENSP00000366246	0.509	Glypican-6
18	9606.ENSP00000253329	0.508	Peptidyl-prolyl cis-trans isomerase-like 4
19	9606.ENSP00000348460	0.508	Neuronal PAS domain-containing protein 3
20	9606.ENSP00000296326	0.505	Probable palmitoyltransferase ZDHHC19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007423	0.994	sensory organ development
GO:0009888	0.992	tissue development
GO:0009987	0.991	cellular process
GO:0032501	0.950	multicellular organismal process
GO:0030855	0.913	epithelial cell differentiation
GO:0007275	0.869	multicellular organism development
GO:0048880	0.847	sensory system development
GO:0042490	0.841	mechanoreceptor differentiation
GO:0009913	0.834	epidermal cell differentiation
GO:0065007	0.623	biological regulation
GO:0050789	0.581	regulation of biological process
GO:0048468	0.541	cell development
GO:0050896	0.498	response to stimulus
GO:0035315	0.437	hair cell differentiation
GO:0050794	0.409	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0043226	0.938	organelle
GO:0005622	0.938	intracellular anatomical structure
GO:0043229	0.933	intracellular organelle
GO:0043227	0.908	membrane-bounded organelle
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0005737	0.731	cytoplasm
GO:0012505	0.351	endomembrane system
GO:0043232	0.301	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]