StarFunc result for job id Q14CM0

User Input

>input (1322 residues)
MDVFSFVKIAKLSSHRTKSSGWPPPSGTWGLSQVPPYGWEMTANRDGRDYFINHMTQAIP
FDDPRLESCQIIPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDQI
VMINDEPVSAAPRERVIDLVRSCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRF
SEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIK
GIEHFSLMLEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRR
DPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEW
GLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYG
GRVFKATLVQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLV
RVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNTATQETGPEN
KGKHNLLGPDWNCIPQMTTFIGEGEQEAQITYIDSKQKTVEITDSTMCPKEHRHLYIDNA
YSSDGLNQQLSQPGEAPCEADYRSLAQRSLLTLSGPETLKKAQESPRGAKVSFIFGDFAL
DDGISPPTLGYETLLDEGPEMLEKQRNLYIGSANDMKGLDLTPEAEGIQFVENSVYANIG
DVKSFQAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDLVVGEMNQPAILNLSGSSDDI
IDLTSLPPPEGDDNEDDFLLRSLNMAIAAPPPGFRDSSDEEDSQSQAASFPEDKEKGSSL
QNDEIPVSLIDAVPTSAEGKCEKGLDNAVVSTLGALEALSVSEEQQTSDNSGVAILRAYS
PESSSDSGNETNSSEMTESSELATAQKQSENLSRMFLATHEGYHPLAEEQTEFPASKTPA
GGLPPKSSHALAARPATDLPPKVVPSKQLLHSDHMEMEPETMETKSVTDYFSKLHMGSVA
YSCTSKRKSKLADGEGKAPPNGNTTGKKQQGTKTAEMEEEASGKFGTVSSRDSQHLSTFN
LERTAFRKDSQRWYVATEGGMAEKSGLEAATGKTFPRASGLGAREAEGKEEGAPDGETSD
GSGLGQGDRFLTDVTCASSAKDLDNPEDADSSTCDHPSKLPEADESVARLCDYHLAKRMS
SLQSEGHFSLQSSQGSSVDAGCGTGSSGSACATPVESPLCPSLGKHLIPDASGKGVNYIP
SEERAPGLPNHGATFKELHPQTEGMCPRMTVPALHTAINTEPLFGTLRDGCHRLPKIKET
TV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A3K7	0.373	0.298	0.000	1705	0.869	0.674	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
2	AFDB:Q14CM0	0.999	0.999	0.000	1322	1.000	1.000	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
3	AFDB:Q5JV73	0.289	0.217	2.808E-55	1810	0.303	0.221	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
4	AFDB:Q5SYB0	0.266	0.225	2.055E-54	1578	0.281	0.236	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
5	AFDB:D3ZW88	0.242	0.233	3.822E-41	1371	0.236	0.228	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
6	PDB:4rm8A	0.189	0.601	1.860E-10	368	0.032	0.114	4rm8A.pdb.gz
7	AFDB:F2Z3U3	0.082	0.085	6.019E-8	1266	0.116	0.121	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
8	PDB:7c3mA	0.178	0.380	4.539E-7	577	0.042	0.097	7c3mA.pdb.gz
9	PDB:6r9tA	0.112	0.072	3.181E-5	2185	0.035	0.021	6r9tA.pdb.gz
10	PDB:7qqmA	0.060	0.183	3.357E-5	413	0.033	0.104	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
11	PDB:7pcbA	0.063	0.192	9.329E-5	415	0.036	0.113	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	AFDB:Q38AE6	0.065	0.070	3.473E-4	1203	0.111	0.122	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
13	AFDB:F1QHL0	0.078	0.097	4.307E-4	1032	0.095	0.121	F1QHL0.pdb.gz
14	PDB:7qqnC	0.084	0.195	7.204E-4	414	0.044	0.140	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	AFDB:O97758	0.074	0.063	7.784E-4	1769	0.132	0.099	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
16	AFDB:Q9Y4H2	0.065	0.064	7.784E-4	1338	0.123	0.121	Q9Y4H2.pdb.gz	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
17	PDB:5n7dA	0.066	0.199	8.465E-4	423	0.036	0.113	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
18	PDB:7pc3A	0.077	0.206	9.427E-4	405	0.035	0.114	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p73A	0.074	0.203	1.450E-3	420	0.039	0.124	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pe9I	0.061	0.246	2.113E-3	317	0.017	0.069	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ALA6	0.0	2493	1759	0.908	0.682	A0A8I6ALA6_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
2	A0A8I6ALF4	0.0	2465	1317	0.899	0.902	A0A8I6ALF4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
3	A0A8I6GKT4	0.0	2373	1705	0.869	0.674	A0A8I6GKT4_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=1
4	D4A3K7	0.0	2461	1777	0.897	0.667	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
5	Q14CM0	0.0	2732	1322	1.000	1.000	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
6	Q5JV73	8.83e-163	535	1810	0.200	0.146	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
7	Q5SYB0	1.38e-142	475	1578	0.180	0.151	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
8	D3ZW88	1.68e-136	457	1549	0.175	0.149	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
9	A0A2R8RR02	7.79e-14	79.3	1101	0.063	0.075	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
10	Q98SN4	1.58e-13	78.2	1050	0.063	0.079	Q98SN4_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak1a PE=1 SV=1
11	Q00944	1.10e-11	72.0	1053	0.066	0.083	FAK1_CHICK Focal adhesion kinase 1 OS=Gallus gallus OX=9031 GN=PTK2 PE=1 SV=2
12	P34152	1.44e-11	71.6	1052	0.066	0.083	FAK1_MOUSE Focal adhesion kinase 1 OS=Mus musculus OX=10090 GN=Ptk2 PE=1 SV=4
13	O35346	2.75e-11	70.9	1055	0.066	0.082	FAK1_RAT Focal adhesion kinase 1 OS=Rattus norvegicus OX=10116 GN=Ptk2 PE=1 SV=1
14	E7ESA6	9.06e-11	69.3	1096	0.065	0.078	E7ESA6_HUMAN non-specific protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
15	Q05397	1.02e-10	68.9	1052	0.065	0.082	FAK1_HUMAN Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2
16	H0YBP1	1.74e-10	68.2	1017	0.051	0.066	H0YBP1_HUMAN non-specific protein-tyrosine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=1
17	Q9QVP9	6.02e-10	66.6	1009	0.051	0.066	FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus OX=10090 GN=Ptk2b PE=1 SV=2
18	P70600	9.13e-10	65.9	1009	0.051	0.066	FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus OX=10116 GN=Ptk2b PE=1 SV=1
19	B7YZL9	3.51e-09	63.9	1500	0.039	0.034	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
20	E1JGM8	4.94e-09	63.5	1198	0.039	0.043	E1JGM8_DROME Focal adhesion kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16511 FERM_f0	12	17.6	N-terminal or F0 domain of Talin-head FERM
2	PF00373 FERM_M	6.6e-15	66.9	FERM central domain
3	PF00595 PDZ	1.7e-06	39.6	PDZ domain
4	PF13180 PDZ_2	0.12	24.1	PDZ domain
5	PF17820 PDZ_6	0.00062	30.9	PDZ domain
6	PF00397 WW	1.9e+02	13.6	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385510	0.800	G-protein-signaling modulator 2
2	9606.ENSP00000328336	0.765	Cell cycle exit and neuronal differentiation protein 1
3	9606.ENSP00000368824	0.652	Connector enhancer of kinase suppressor of ras 2
4	9606.ENSP00000258302	0.651	Regulator of G-protein signaling 8
5	9606.ENSP00000419782	0.649	Cyclin-dependent-like kinase 5
6	9606.ENSP00000362111	0.628	Tetraspanin-6
7	9606.ENSP00000332791	0.612	Kelch-like protein 15
8	9606.ENSP00000420854	0.605	EF-hand calcium-binding domain-containing protein 12
9	9606.ENSP00000427951	0.604	Coiled-coil domain containing 160
10	9606.ENSP00000274217	0.602	Inactive ubiquitin thioesterase FAM105A
11	9606.ENSP00000262726	0.599	EF-hand calcium-binding domain-containing protein 6
12	9606.ENSP00000382428	0.575	Disks large homolog 4
13	9606.ENSP00000366265	0.574	Zinc finger protein 41
14	9606.ENSP00000362444	0.563	Disks large-associated protein 3
15	9606.ENSP00000481917	0.550	Seizure 6-like protein 2
16	9606.ENSP00000363944	0.542	Ribosomal biogenesis protein LAS1L
17	9606.ENSP00000365606	0.532	GRIP1-associated protein 1
18	9606.ENSP00000357836	0.528	Sorting nexin-27
19	9606.ENSP00000333779	0.515	Protein EVI2B
20	9606.ENSP00000450832	0.511	Signal-induced proliferation-associated 1-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043168	0.997	anion binding
GO:1902936	0.996	phosphatidylinositol bisphosphate binding
GO:0005546	0.992	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030029	0.997	actin filament-based process
GO:0099173	0.994	postsynapse organization
GO:0007010	0.946	cytoskeleton organization
GO:0030036	0.925	actin cytoskeleton organization
GO:0065007	0.879	biological regulation
GO:0050789	0.862	regulation of biological process
GO:0050794	0.826	regulation of cellular process
GO:0048518	0.356	positive regulation of biological process
GO:0048522	0.333	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0098794	0.998	postsynapse
GO:0014069	0.952	postsynaptic density
GO:0098978	0.920	glutamatergic synapse
GO:0071944	0.870	cell periphery
GO:0005886	0.855	plasma membrane
GO:0005622	0.807	intracellular anatomical structure
GO:0043227	0.724	membrane-bounded organelle
GO:0043229	0.722	intracellular organelle
GO:0005737	0.713	cytoplasm
GO:0120025	0.409	plasma membrane bounded cell projection
GO:0043005	0.375	neuron projection
GO:0036477	0.345	somatodendritic compartment
GO:0043197	0.337	dendritic spine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]