StarFunc result for job id Q14CN4

User Input

>input (511 residues)
MSRQLTHFPRGERLGFSGCSAVLSGGIGSSSASFRARVKGSASFGSKSLSCLGGSRSLAL
SAAARRGGGRLGGFVGTAFGSAGLGPKCPSVCPPGGIPQVTVNKSLLAPLNVEMDPEIQR
VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI
SNLQKQLEMLSGDGVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDVDAAY
MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSIVLSMDNNRDLDLDSIIAEVR
AQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNRLIQRIRSEIGNV
KKQCADLETAIADAEQRGDCALKDARAKLDELEGALHQAKEELARMLREYQELVSLKLAL
DMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAA
DVKTKGSCGSELKDPLAKTSGSSCATKKASR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CN4	1.000	1.000	9.680E-66	511	1.000	1.000	Q14CN4.pdb.gz	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
2	AFDB:Q9R0H5	0.320	0.313	4.861E-42	524	0.734	0.716	Q9R0H5.pdb.gz	K2C71_MOUSE Keratin, type II cytoskeletal 71 OS=Mus musculus OX=10090 GN=Krt71 PE=1 SV=1
3	AFDB:Q86Y46	0.319	0.303	2.397E-40	540	0.748	0.707	Q86Y46.pdb.gz	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
4	AFDB:P19013	0.651	0.641	2.314E-35	520	0.614	0.604	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
5	AFDB:Q8BGZ7	0.372	0.349	1.406E-34	551	0.609	0.564	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
6	AFDB:Q9Z331	0.303	0.279	1.226E-33	562	0.605	0.550	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	AFDB:A0A1D5PXP0	0.353	0.347	1.149E-32	522	0.573	0.561	A0A1D5PXP0.pdb.gz
8	AFDB:O95678	0.300	0.281	1.534E-32	551	0.597	0.554	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
9	AFDB:P02538	0.302	0.276	1.649E-32	564	0.603	0.546	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
10	AFDB:Q5XKE5	0.437	0.421	2.733E-32	535	0.564	0.538	Q5XKE5.pdb.gz	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
11	PDB:7mqaNA	0.055	0.081	5.691E-1	295	0.043	0.075	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:8at3A	0.146	0.228	1.942	286	0.070	0.126	8at3A.pdb.gz
13	PDB:5wlcST	0.087	0.075	7.653	599	0.037	0.032	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
14	PDB:6u424R	0.181	0.244	8.841	366	0.084	0.117	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95678	0.0	553	551	0.558	0.517	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	0.0	554	564	0.521	0.472	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	0.0	554	564	0.519	0.470	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P07744	0.0	522	525	0.540	0.526	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
5	P13647	0.0	540	590	0.499	0.432	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
6	P19013	0.0	556	520	0.575	0.565	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
7	P48668	0.0	553	564	0.519	0.470	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
8	P50446	0.0	552	553	0.511	0.472	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
9	Q14CN4	0.0	1043	511	1.000	1.000	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
10	Q3SY84	0.0	710	523	0.751	0.734	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
11	Q5XKE5	0.0	533	535	0.526	0.503	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
12	Q6P6Q2	0.0	542	576	0.505	0.448	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
13	Q7RTS7	0.0	679	529	0.712	0.688	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
14	Q86Y46	0.0	712	540	0.748	0.707	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
15	Q8BGZ7	0.0	552	551	0.566	0.525	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
16	Q922U2	0.0	535	580	0.495	0.436	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
17	Q9R0H5	0.0	689	524	0.730	0.712	K2C71_MOUSE Keratin, type II cytoskeletal 71 OS=Mus musculus OX=10090 GN=Krt71 PE=1 SV=1
18	Q9Z331	0.0	552	562	0.564	0.512	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
19	Q3UV17	1.63e-180	521	594	0.499	0.429	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
20	Q6PVZ5	1.34e-179	519	599	0.485	0.414	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	1.7e+02	13.7	Afadin- and alpha -actinin-Binding
2	PF08614 ATG16	1.4e+02	14.1	Autophagy protein 16 (ATG16)
3	PF04513 Baculo_PEP_C	7.2e+02	11.6	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF10473 CENP-F_leu_zip	0.0007	31.1	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF16888 DUF5082	5.5e+02	12.3	Domain of unknown function (DUF5082)
6	PF05218 DUF713	3.7e+02	12.3	Protein of unknown function (DUF713)
7	PF00038 Filament	1.2e-101	352.0	Intermediate filament protein
8	PF16208 Keratin_2_head	1.7e-12	59.2	Keratin type II head
9	PF07926 TPR_MLP1_2	1.2e+02	14.1	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353496	0.708	Leucine zipper putative tumor suppressor 3
2	9606.ENSP00000385285	0.707	RING finger protein 32
3	9606.ENSP00000307014	0.689	Keratin, type II cytoskeletal 73
4	9606.ENSP00000359240	0.634	Leucine zipper putative tumor suppressor 2
5	9606.ENSP00000310861	0.575	Keratin, type II cytoskeletal 2 epidermal
6	9606.ENSP00000252244	0.544	Keratin, type II cytoskeletal 1
7	9606.ENSP00000257951	0.527	Keratin, type II cuticular Hb4
8	9606.ENSP00000257974	0.526	Keratin, type II cuticular Hb2
9	9606.ENSP00000378292	0.524	Keratin, type II cytoskeletal 80
10	9606.ENSP00000257901	0.523	Keratin, type II cuticular Hb5
11	9606.ENSP00000330101	0.521	Keratin, type II cytoskeletal 2 oral
12	9606.ENSP00000329243	0.518	Keratin, type II cytoskeletal 7
13	9606.ENSP00000369349	0.518	Keratin, type II cuticular Hb1
14	9606.ENSP00000413479	0.518	Keratin, type II cytoskeletal 3
15	9606.ENSP00000306261	0.516	Keratin, type II cytoskeletal 78
16	9606.ENSP00000369317	0.514	Keratin, type II cytoskeletal 6A
17	9606.ENSP00000448220	0.514	Keratin, type II cytoskeletal 4
18	9606.ENSP00000252242	0.513	Keratin, type II cytoskeletal 5
19	9606.ENSP00000252252	0.512	Keratin, type II cytoskeletal 6B
20	9606.ENSP00000293670	0.511	Keratin, type II cuticular Hb3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.814	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0045103	0.975	intermediate filament-based process
GO:0032502	0.926	developmental process
GO:0048856	0.911	anatomical structure development
GO:0045104	0.861	intermediate filament cytoskeleton organization
GO:0008544	0.555	epidermis development
GO:0032501	0.373	multicellular organismal process
GO:0043588	0.314	skin development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0005615	0.996	extracellular space
GO:0043229	0.992	intracellular organelle
GO:0070062	0.979	extracellular exosome
GO:0043228	0.968	non-membrane-bounded organelle
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0045095	0.887	keratin filament
GO:0043231	0.464	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]