StarFunc result for job id Q14CW9

User Input

>input (347 residues)
MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKD
FEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRI
ANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNSPRRSKSLKHKNGELSNS
DPFKYNNSTGISYETLGPEELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIY
FLGPSAVLPEVESSLDNDSFDMTDSQALISRLQWDGSSDLSPSDSGSSKTSENQGWGLGT
NSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPTPSIYDDIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CW9	1.000	1.000	3.105E-59	347	1.000	1.000	Q14CW9.pdb.gz	AT7L3_HUMAN Ataxin-7-like protein 3 OS=Homo sapiens OX=9606 GN=ATXN7L3 PE=1 SV=1
2	PDB:3mhhC	0.189	0.510	1.103E-3	93	0.066	0.247	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
3	AFDB:E7F640	0.127	0.068	3.624E-3	866	0.193	0.077	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
4	AFDB:Q8VD12	0.112	0.104	1.204E-2	386	0.124	0.111	Q8VD12.pdb.gz	Z385A_MOUSE Zinc finger protein 385A OS=Mus musculus OX=10090 GN=Znf385a PE=1 SV=2
5	AFDB:A0A2R8YDD6	0.105	0.053	3.065E-2	892	0.179	0.070	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
6	AFDB:Q7K3G5	0.083	0.064	1.520E-1	497	0.121	0.085	Q7K3G5.pdb.gz	Q7K3G5_DROME D4, isoform A OS=Drosophila melanogaster OX=7227 GN=d4 PE=1 SV=1
7	AFDB:O80942	0.096	0.106	4.725E-1	304	0.121	0.138	O80942.pdb.gz	ZFP10_ARATH Zinc finger protein 10 OS=Arabidopsis thaliana OX=3702 GN=ZFP10 PE=2 SV=1
8	AFDB:Q9UM63	0.085	0.071	5.051E-1	463	0.147	0.110	Q9UM63.pdb.gz	PLAL1_HUMAN Zinc finger protein PLAGL1 OS=Homo sapiens OX=9606 GN=PLAGL1 PE=1 SV=2
9	AFDB:P29536	0.102	0.064	5.400E-1	600	0.138	0.080	P29536.pdb.gz	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
10	AFDB:Q9C911	0.097	0.058	5.400E-1	630	0.121	0.067	Q9C911.pdb.gz	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
11	AFDB:O95810	0.115	0.100	6.171E-1	425	0.130	0.106	O95810.pdb.gz	CAVN2_HUMAN Caveolae-associated protein 2 OS=Homo sapiens OX=9606 GN=CAVIN2 PE=1 SV=3
12	PDB:6ydhA	0.052	0.236	1.814	62	0.023	0.129	6ydhA.pdb.gz
13	PDB:5dkaA	0.071	0.250	2.073	96	0.014	0.052	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:7nacm	0.067	0.041	2.369	666	0.092	0.048	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:6t9lN	0.068	0.254	2.707	82	0.035	0.146	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
16	PDB:3w5kB	0.066	0.181	3.307	110	0.012	0.036	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
17	PDB:7uhyC	0.071	0.047	3.307	578	0.052	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:6dk4A	0.046	0.093	4.040	135	0.032	0.081	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
19	PDB:2mphA	0.092	0.131	4.319	224	0.037	0.058	2mphA.pdb.gz
20	PDB:4etsB	0.070	0.126	4.319	149	0.032	0.074	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14CW9	0.0	717	347	1.000	1.000	AT7L3_HUMAN Ataxin-7-like protein 3 OS=Homo sapiens OX=9606 GN=ATXN7L3 PE=1 SV=1
2	Q9VVR6	2.66e-26	105	196	0.184	0.327	SGF11_DROME SAGA-associated factor 11 homolog OS=Drosophila melanogaster OX=7227 GN=Sgf11 PE=1 SV=2
3	Q96GX2	5.81e-25	99.0	97	0.135	0.485	A7L3B_HUMAN Ataxin-7-like protein 3B OS=Homo sapiens OX=9606 GN=ATXN7L3B PE=1 SV=2
4	Q94BV2	1.86e-10	61.6	181	0.115	0.221	SGF11_ARATH SAGA-associated factor 11 OS=Arabidopsis thaliana OX=3702 GN=SGF11 PE=1 SV=1
5	Q5FC18	0.001	40.4	117	0.089	0.265	SGF11_SCHPO SAGA-associated factor 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgf11 PE=3 SV=1
6	N1NXA6	0.006	38.1	99	0.052	0.182	N1NXA6_YEASC SAGA-associated factor 11 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=SGF11 PE=1 SV=1
7	Q03067	0.006	38.1	99	0.052	0.182	SGF11_YEAST SAGA-associated factor 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGF11 PE=1 SV=1
8	A4D0Q3	0.013	40.0	759	0.066	0.030	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
9	Q9ULK2	0.015	39.7	861	0.066	0.027	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
10	A0A2R8YDD6	0.028	38.9	892	0.052	0.020	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
11	O15265	0.029	38.9	892	0.052	0.020	ATX7_HUMAN Ataxin-7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
12	Q8R4I1	0.031	38.9	867	0.052	0.021	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
13	E7F640	0.30	35.4	866	0.043	0.017	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
14	O94397	3.0	32.0	344	0.115	0.116	SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgf73 PE=3 SV=1
15	Q6ZW76	7.1	31.2	656	0.121	0.064	ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ANKS3 PE=1 SV=1
16	Q9P2K3	7.6	30.8	495	0.055	0.038	RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens OX=9606 GN=RCOR3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12235 FXMRP1_C_core	35	16.5	Fragile X-related 1 protein core C terminal
2	PF08313 SCA7	0.00059	31.0	SCA7, zinc-binding domain
3	PF08209 Sgf11	9.9e-15	65.1	Sgf11 (transcriptional regulation protein)
4	PF13913 zf-C2HC_2	1e+02	14.2	zinc-finger of a C2HC-type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000014542

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007847	0.983	Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates to a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor- me [...]
2	60711.ENSCSAP00000013885	0.981	SPT20 homolog, SAGA complex component
3	60711.ENSCSAP00000012118	0.974	Transcriptional adaptor 2B
4	60711.ENSCSAP00000002544	0.969	SAGA complex associated factor 29
5	60711.ENSCSAP00000006802	0.966	Transcriptional adaptor 3
6	60711.ENSCSAP00000013789	0.963	Transformation/transcription domain-associated protein
7	60711.ENSCSAP00000008655	0.962	SPT3 homolog, SAGA and STAGA complex component
8	60711.ENSCSAP00000000693	0.960	TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors
9	60711.ENSCSAP00000008162	0.954	Ataxin 7
10	60711.ENSCSAP00000003963	0.951	Ubiquitinyl hydrolase 1
11	60711.ENSCSAP00000014955	0.943	Belongs to the acetyltransferase family. GCN5 subfamily.
12	60711.ENSCSAP00000016996	0.941	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
13	60711.ENSCSAP00000017861	0.930	Ubiquitin specific peptidase 27, X-linked
14	60711.ENSCSAP00000006481	0.922	SPT7 like, STAGA complex gamma subunit
15	60711.ENSCSAP00000007637	0.919	Ataxin 7-like 1
16	60711.ENSCSAP00000006830	0.918	TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
17	60711.ENSCSAP00000007013	0.909	Transcriptional adaptor 1
18	60711.ENSCSAP00000006048	0.903	K(lysine) acetyltransferase 2B
19	60711.ENSCSAP00000002405	0.898	Transcriptional adaptor 2A
20	60711.ENSCSAP00000003007	0.884	TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030374	1.000	nuclear receptor coactivator activity
GO:0097159	0.503	organic cyclic compound binding
GO:0003676	0.480	nucleic acid binding
GO:0003677	0.420	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019219	0.987	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.973	organic substance metabolic process
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0044238	0.967	primary metabolic process
GO:0048518	0.958	positive regulation of biological process
GO:0070647	0.958	protein modification by small protein conjugation or removal
GO:0032446	0.948	protein modification by small protein conjugation
GO:0045893	0.945	positive regulation of DNA-templated transcription
GO:0016579	0.944	protein deubiquitination
GO:0016567	0.939	protein ubiquitination
GO:0006357	0.935	regulation of transcription by RNA polymerase II
GO:0006513	0.908	protein monoubiquitination
GO:0043543	0.905	protein acylation
GO:0016578	0.879	histone deubiquitination
GO:0018394	0.868	peptidyl-lysine acetylation
GO:0043966	0.863	histone H3 acetylation
GO:0016574	0.827	histone ubiquitination
GO:0009987	0.393	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.999	nuclear protein-containing complex
GO:0000124	0.998	SAGA complex
GO:0071819	0.776	DUBm complex
GO:0031981	0.495	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]