StarFunc result for job id Q14CX7

User Input

>input (972 residues)
MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGK
QEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLF
MAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERM
VEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYK
KLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVHYSAE
KAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFG
DKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQL
TRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWR
ETGDETTVWQALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHD
TIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFR
NRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWEDLRDNRDLNV
FFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHPVEPKNSEKTAENGV
SSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLV
NDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLEN
LVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTL
ISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELL
KKRLETTKKLKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CX7	1.000	1.000	0.000	972	1.000	1.000	Q14CX7.pdb.gz	NAA25_HUMAN N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25 PE=1 SV=1
2	AFDB:Q6QI44	0.947	0.948	8.230E-96	970	0.885	0.887	Q6QI44.pdb.gz	NAA25_RAT N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Rattus norvegicus OX=10116 GN=Naa25 PE=2 SV=1
3	PDB:6vp9B	0.909	0.966	1.225E-82	914	0.934	0.993	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
4	AFDB:Q9VDQ7	0.838	0.859	2.181E-43	948	0.313	0.321	Q9VDQ7.pdb.gz	NAA25_DROME Phagocyte signaling-impaired protein OS=Drosophila melanogaster OX=7227 GN=psidin PE=2 SV=1
5	AFDB:F4KEY9	0.732	0.672	3.895E-28	1065	0.214	0.195	F4KEY9.pdb.gz	NAA25_ARATH N-terminal acetyltransferase B complex auxiliary subunit NAA25 OS=Arabidopsis thaliana OX=3702 GN=NAA25 PE=2 SV=1
6	AFDB:Q9Y809	0.664	0.783	3.799E-22	811	0.177	0.212	Q9Y809.pdb.gz	NAA25_SCHPO N-terminal acetyltransferase B complex subunit arm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arm1 PE=3 SV=1
7	AFDB:Q585L6	0.665	0.739	3.389E-21	862	0.170	0.191	Q585L6.pdb.gz	Q585L6_TRYB2 N-acetyltransferase B complex (NatB) non catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1160 PE=3 SV=1
8	AFDB:Q12387	0.528	0.627	3.704E-16	796	0.160	0.196	Q12387.pdb.gz	NAA25_YEAST N-terminal acetyltransferase B complex subunit MDM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM20 PE=1 SV=1
9	AFDB:F4HS68	0.436	0.461	1.274E-10	911	0.133	0.142	F4HS68.pdb.gz	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
10	AFDB:A4FU51	0.424	0.469	2.642E-10	864	0.122	0.138	A4FU51.pdb.gz	A4FU51_HUMAN NMDA receptor regulated 1-like OS=Homo sapiens OX=9606 GN=NARG1L PE=2 SV=1
11	AFDB:A0A0R4I9S5	0.418	0.460	4.009E-10	865	0.116	0.131	A0A0R4I9S5.pdb.gz	A0A0R4I9S5_DANRE N(Alpha)-acetyltransferase 15, NatA auxiliary subunit b OS=Danio rerio OX=7955 GN=fi31d06 PE=1 SV=2
12	PDB:6c95A	0.376	0.455	1.067E-9	773	0.104	0.131	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
13	PDB:4kvmB	0.406	0.520	1.797E-9	722	0.100	0.134	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
14	PDB:6hd7t	0.368	0.415	3.211E-8	838	0.126	0.146	6hd7t.pdb.gz	Ribosome-NatA architecture reveals that rRNA expansion segments coordinate N-terminal acetylation.
15	PDB:4hnxA	0.432	0.559	3.442E-8	713	0.112	0.153	4hnxA.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
16	PDB:4xnhA	0.433	0.519	1.888E-7	786	0.112	0.139	4xnhA.pdb.gz	Crystal structure of yeast N-terminal acetyltransferase NatE (IP6) in complex with a bisubstrate
17	PDB:4bujB	0.186	0.142	3.653E-7	1367	0.098	0.069	4bujB.pdb.gz
18	PDB:7qdrB	0.155	0.129	4.824E-7	1212	0.117	0.094	7qdrB.pdb.gz
19	PDB:7dkhI	0.142	0.148	7.502E-6	914	0.110	0.117	7dkhI.pdb.gz
20	PDB:7qe7J	0.142	0.227	1.556E-5	510	0.076	0.145	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14CX7	0.0	2008	972	1.000	1.000	NAA25_HUMAN N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25 PE=1 SV=1
2	Q6QI44	0.0	1805	970	0.886	0.888	NAA25_RAT N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Rattus norvegicus OX=10116 GN=Naa25 PE=2 SV=1
3	Q9VDQ7	8.44e-135	431	948	0.271	0.277	NAA25_DROME Phagocyte signaling-impaired protein OS=Drosophila melanogaster OX=7227 GN=psidin PE=2 SV=1
4	F4KEY9	1.31e-44	177	1065	0.182	0.166	NAA25_ARATH N-terminal acetyltransferase B complex auxiliary subunit NAA25 OS=Arabidopsis thaliana OX=3702 GN=NAA25 PE=2 SV=1
5	Q9Y809	4.09e-29	127	811	0.165	0.197	NAA25_SCHPO N-terminal acetyltransferase B complex subunit arm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arm1 PE=3 SV=1
6	Q585L6	1.85e-17	90.1	862	0.144	0.162	Q585L6_TRYB2 N-acetyltransferase B complex (NatB) non catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1160 PE=3 SV=1
7	Q12387	1.15e-04	48.5	796	0.112	0.137	NAA25_YEAST N-terminal acetyltransferase B complex subunit MDM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDM20 PE=1 SV=1
8	Q3UV71	0.12	38.9	942	0.064	0.066	TMTC1_MOUSE Protein O-mannosyl-transferase TMTC1 OS=Mus musculus OX=10090 GN=Tmtc1 PE=2 SV=2
9	Q8IUR5	0.23	37.7	882	0.060	0.066	TMTC1_HUMAN Protein O-mannosyl-transferase TMTC1 OS=Homo sapiens OX=9606 GN=TMTC1 PE=1 SV=3
10	F4HS68	0.28	37.4	911	0.059	0.063	F4HS68_ARATH Tetratricopeptide repeat (TPR)-containing protein OS=Arabidopsis thaliana OX=3702 GN=NAA15 PE=1 SV=1
11	Q9Y7X2	0.80	35.8	695	0.029	0.040	YOP2_SCHPO N-terminal acetyltransferase A complex subunit-like protein C418.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC418.02 PE=3 SV=1
12	Q03720	1.3	35.4	1200	0.029	0.023	SLO_DROME Calcium-activated potassium channel slowpoke OS=Drosophila melanogaster OX=7227 GN=slo PE=1 SV=3
13	Q49SP6	1.3	35.4	554	0.025	0.043	TPGD2_POGCB Germacrene D synthase 2 OS=Pogostemon cablin OX=28511 PE=1 SV=1
14	Q9VUQ8	1.3	34.7	288	0.021	0.069	DCN1L_DROME DCN1-like protein OS=Drosophila melanogaster OX=7227 GN=CG7427 PE=2 SV=2
15	Q5T4D3	1.7	35.0	741	0.022	0.028	TMTC4_HUMAN Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
16	Q9M1I1	1.9	35.0	1378	0.042	0.030	FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana OX=3702 GN=At3g54460 PE=2 SV=1
17	A0A0R4IVJ0	2.6	34.3	1102	0.037	0.033	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
18	Q8BG19	3.4	33.9	741	0.022	0.028	TMTC4_MOUSE Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
19	C0LGS2	4.8	33.5	1136	0.022	0.018	Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana OX=3702 GN=At4g36180 PE=1 SV=1
20	Q10305	8.3	32.3	440	0.039	0.086	GDI1_SCHPO Probable secretory pathway GDP dissociation inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gdi1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14863 Alkyl_sulf_dimr	4.5e+02	12.6	Alkyl sulfatase dimerisation
2	PF12895 ANAPC3	1.9e+02	13.7	Anaphase-promoting complex, cyclosome, subunit 3
3	PF03704 BTAD	4e+02	12.8	Bacterial transcriptional activator domain
4	PF09797 NatB_MDM20	2e-127	436.9	N-acetyltransferase B complex (NatB) non catalytic subunit
5	PF20308 TPR-S	4e+02	13.0	Tetratricopeptide Repeats-Sensor
6	PF00515 TPR_1	6.3e+02	11.7	Tetratricopeptide repeat
7	PF13428 TPR_14	0.035	25.9	Tetratricopeptide repeat
8	PF13431 TPR_17	6.5e+02	12.2	Tetratricopeptide repeat
9	PF14559 TPR_19	1.4	20.8	Tetratricopeptide repeat
10	PF07719 TPR_2	53	15.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335636	0.999	N-alpha-acetyltransferase 20
2	9606.ENSP00000452521	0.974	N-alpha-acetyltransferase 30
3	9606.ENSP00000296543	0.972	N-alpha-acetyltransferase 15, NatA auxiliary subunit
4	9606.ENSP00000240922	0.965	N-alpha-acetyltransferase 50
5	9606.ENSP00000354972	0.944	N-alpha-acetyltransferase 35, NatC auxiliary subunit
6	9606.ENSP00000417763	0.941	N-alpha-acetyltransferase 10
7	9606.ENSP00000368716	0.923	N-alpha-acetyltransferase 16, NatA auxiliary subunit
8	9606.ENSP00000296456	0.902	Acylamino-acid-releasing enzyme
9	9606.ENSP00000286794	0.901	N-alpha-acetyltransferase 11
10	9606.ENSP00000469413	0.835	Serine/threonine-protein kinase PAK 4
11	9606.ENSP00000355890	0.826	Bifunctional glutamate/proline--tRNA ligase
12	9606.ENSP00000367024	0.817	N-alpha-acetyltransferase 40
13	9606.ENSP00000367498	0.807	Leucine-rich repeat-containing protein 47
14	9606.ENSP00000385903	0.773	N-alpha-acetyltransferase 60
15	9606.ENSP00000351022	0.709	Tropomyosin alpha-1 chain
16	9606.ENSP00000478783	0.701	E3 ubiquitin-protein ligase listerin
17	9606.ENSP00000356652	0.689	Calcyclin-binding protein
18	9606.ENSP00000361423	0.682	Tyrosine-protein kinase ABL1
19	9606.ENSP00000367542	0.624	Tropomyosin beta chain
20	9606.ENSP00000272425	0.622	N-acetyltransferase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.352	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0006473	0.993	protein acetylation
GO:0051604	0.992	protein maturation
GO:0031365	0.992	N-terminal protein amino acid modification
GO:0018193	0.974	peptidyl-amino acid modification
GO:0009987	0.585	cellular process
GO:0065007	0.379	biological regulation
GO:0006474	0.374	N-terminal protein amino acid acetylation
GO:0050789	0.350	regulation of biological process
GO:0050794	0.304	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.990	endomembrane system
GO:0043227	0.975	membrane-bounded organelle
GO:0043229	0.975	intracellular organelle
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005829	0.961	cytosol
GO:0032991	0.960	protein-containing complex
GO:1902494	0.871	catalytic complex
GO:1990234	0.845	transferase complex
GO:0140535	0.766	intracellular protein-containing complex
GO:0005794	0.672	Golgi apparatus
GO:1902493	0.667	acetyltransferase complex
GO:0031248	0.660	protein acetyltransferase complex
GO:0031414	0.612	N-terminal protein acetyltransferase complex
GO:0070013	0.553	intracellular organelle lumen
GO:0005634	0.463	nucleus
GO:0031981	0.427	nuclear lumen
GO:0005654	0.335	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]