StarFunc result for job id Q14CZ0

User Input

>input (275 residues)
MEERKEEGEAEIQEHGPEHWFSKWERQCLAEAEQDEQLPPELQEEAAAAAQPEHKQQKLW
HLFQNSATAVAQLYKDRVCQQPGLSLWVPFQNAATAVTNLYKESVDTHQRSFDIGIQIGY
QRRNKDVLAWVKKRRRTIRREDLISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSV
ETDLQPFREAIALHGLSGAMASISVRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISE
EMALHLDNGGTRKRTSAQCGDVITDSPTHKRNRMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CZ0	1.000	1.000	1.480E-38	275	1.000	1.000	Q14CZ0.pdb.gz	HAPR1_HUMAN HUWE1-associated protein modifying stress responses 1 OS=Homo sapiens OX=9606 GN=HAPSTR1 PE=1 SV=1
2	AFDB:O42871	0.300	0.293	2.593E-2	283	0.113	0.110	O42871.pdb.gz	ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=png1 PE=3 SV=1
3	AFDB:Q9VEF5	0.306	0.206	3.317E-2	433	0.142	0.090	Q9VEF5.pdb.gz	Q9VEF5_DROME Inhibitor of growth protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7379 PE=1 SV=1
4	AFDB:Q05543	0.207	0.155	3.990E-2	409	0.102	0.068	Q05543.pdb.gz	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
5	AFDB:C7FZZ5	0.253	0.209	4.244E-2	344	0.084	0.067	C7FZZ5.pdb.gz	C7FZZ5_DICDI BAR domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275301 PE=4 SV=1
6	AFDB:Q12343	0.162	0.157	4.513E-2	284	0.135	0.130	Q12343.pdb.gz	MED4_YEAST Mediator of RNA polymerase II transcription subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED4 PE=1 SV=1
7	AFDB:A0A1D8PIP3	0.224	0.149	6.531E-2	481	0.127	0.073	A0A1D8PIP3.pdb.gz	A0A1D8PIP3_CANAL Chromatin modification-related protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO23 PE=3 SV=1
8	AFDB:Q54PN9	0.187	0.162	6.531E-2	324	0.124	0.105	Q54PN9.pdb.gz	ING1_DICDI Inhibitor of growth protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=dng1 PE=1 SV=1
9	AFDB:E9QGC4	0.198	0.056	7.856E-2	1112	0.164	0.040	E9QGC4.pdb.gz	E9QGC4_DANRE Protein KIBRA OS=Danio rerio OX=7955 GN=wwc1 PE=4 SV=2
10	AFDB:Q02040	0.174	0.073	8.355E-2	695	0.149	0.059	Q02040.pdb.gz	AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2
11	PDB:2b5uA	0.293	0.184	1.155E-1	470	0.084	0.049	2b5uA.pdb.gz
12	PDB:5ew5A	0.219	0.144	2.573E-1	490	0.087	0.049	5ew5A.pdb.gz
13	PDB:7nsuD	0.221	0.162	2.736E-1	420	0.087	0.057	7nsuD.pdb.gz
14	PDB:7nvrk	0.192	0.382	6.893E-1	133	0.062	0.128	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
15	PDB:7suk6	0.172	0.171	9.379E-1	277	0.095	0.094	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
16	PDB:6wucH	0.173	0.247	9.975E-1	179	0.120	0.184	6wucH.pdb.gz
17	PDB:6tuyA	0.233	0.111	1.061	667	0.055	0.022	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
18	PDB:7z37DP1	0.161	0.163	1.200	273	0.069	0.070	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
19	PDB:2qkwA	0.188	0.417	1.276	101	0.055	0.149	2qkwA.pdb.gz
20	PDB:5n9jG	0.229	0.360	1.276	163	0.073	0.123	5n9jG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14CZ0	0.0	573	275	1.000	1.000	HAPR1_HUMAN HUWE1-associated protein modifying stress responses 1 OS=Homo sapiens OX=9606 GN=HAPSTR1 PE=1 SV=1
2	A2BE76	3.10e-144	407	265	0.793	0.823	HAPR1_DANRE HUWE1-associated protein modifying stress responses OS=Danio rerio OX=7955 GN=hapstr1 PE=2 SV=1
3	O61766	0.92	33.1	383	0.073	0.052	O61766_CAEEL Protein odr-4 homolog OS=Caenorhabditis elegans OX=6239 GN=slfl-3 PE=1 SV=3
4	Q01722	2.3	32.0	534	0.109	0.056	GCR2_YEAST Glycolytic genes transcriptional activator GCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCR2 PE=1 SV=1
5	Q80TR8	2.8	32.0	1506	0.109	0.020	DCAF1_MOUSE DDB1- and CUL4-associated factor 1 OS=Mus musculus OX=10090 GN=Dcaf1 PE=1 SV=4
6	Q9Y4B6	3.5	31.6	1507	0.109	0.020	DCAF1_HUMAN DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1 PE=1 SV=3
7	Q15120	3.7	31.6	406	0.076	0.052	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
8	Q9SDM9	4.2	31.2	470	0.047	0.028	JAL28_ARATH Thiohydroximate-O-sulfate sulfur/sulfate-lyase (nitrile-forming) NSP1 OS=Arabidopsis thaliana OX=3702 GN=NSP1 PE=1 SV=2
9	Q8R507	5.1	31.2	461	0.055	0.033	FKTN_MOUSE Ribitol-5-phosphate transferase FKTN OS=Mus musculus OX=10090 GN=Fktn PE=1 SV=1
10	Q4KMQ1	8.5	30.4	711	0.051	0.020	TPRN_HUMAN Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15251 DUF4588	1.9e-98	340.8	Domain of unknown function (DUF4588)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007469997.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007450597.1	0.567	Protein CIP2A
2	118797.XP_007471751.1	0.560	Ribonuclease H2 subunit B isoform X1
3	118797.XP_007453062.1	0.550	DNA polymerase epsilon subunit 4
4	118797.XP_007456896.1	0.539	Interleukin-1 receptor-like 2
5	118797.XP_007465757.1	0.539	MOB family member 4, phocein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.896	regulation of cellular process
GO:0009987	0.831	cellular process
GO:1901796	0.830	regulation of signal transduction by p53 class mediator
GO:0009968	0.681	negative regulation of signal transduction
GO:0080134	0.637	regulation of response to stress
GO:1901797	0.629	negative regulation of signal transduction by p53 class mediator
GO:0080135	0.556	regulation of cellular response to stress
GO:0008152	0.479	metabolic process
GO:0050896	0.426	response to stimulus
GO:0044237	0.403	cellular metabolic process
GO:0071704	0.375	organic substance metabolic process
GO:0006807	0.352	nitrogen compound metabolic process
GO:0044238	0.301	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.894	intracellular organelle lumen
GO:0031981	0.867	nuclear lumen
GO:0005654	0.762	nucleoplasm
GO:0032991	0.729	protein-containing complex
GO:0005667	0.352	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]