StarFunc result for job id Q14CZ7

User Input

>input (662 residues)
MALITLRKNLYRLSDFQMHRALAALKNKPLNHVHKVVKERLCPWLCSRQPEPFGVKFHHA
HCKKFHSKNGNDLHPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFIS
TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQLSNTSLVT
ALQALILLHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILGESLITLHSSGCVTLELII
NQLQGEKLETFTPEDIVALYRILQACTEKVDEHQTFLNKINNFSLSIVSNLSPKLISQML
TALVVLDQSQAFPLIIKLGKYVVRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVA
AVCLTLDPEVVCRVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNY
LPPNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKPLFLQRLQG
KESHLDTLSRAQLTQLFLASVLECPFYKGPKLLPKYQVKSFLTPCCSLETPVDSQLYRYV
KIGLTNLLGARLYFAPKVLTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKR
FCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWL
QE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14CZ7	1.000	1.000	4.004E-84	662	1.000	1.000	Q14CZ7.pdb.gz	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
2	AFDB:B4DU42	0.571	0.587	1.548E-23	642	0.196	0.202	B4DU42.pdb.gz	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q91YM4	0.597	0.623	1.861E-22	630	0.198	0.208	Q91YM4.pdb.gz	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
4	AFDB:Q7L8L6	0.580	0.513	1.112E-19	764	0.196	0.170	Q7L8L6.pdb.gz	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
5	AFDB:A0A024R3X5	0.594	0.559	1.858E-19	710	0.166	0.155	A0A024R3X5.pdb.gz
6	AFDB:Q922E6	0.615	0.594	5.836E-19	689	0.175	0.168	Q922E6.pdb.gz	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
7	AFDB:Q53R41	0.394	0.313	2.446E-16	847	0.189	0.148	Q53R41.pdb.gz	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
8	AFDB:Q14296	0.431	0.514	4.250E-16	549	0.181	0.219	Q14296.pdb.gz	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
9	AFDB:Q8VZE7	0.335	0.331	1.137E-9	671	0.144	0.142	Q8VZE7.pdb.gz	RAP_ARATH RAP domain-containing protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAP PE=1 SV=1
10	AFDB:Q57ZX7	0.415	0.510	3.713E-9	516	0.104	0.134	Q57ZX7.pdb.gz	Q57ZX7_TRYB2 Guide RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.120 PE=4 SV=1
11	PDB:7a9wA	0.225	0.267	1.475E-3	513	0.088	0.113	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
12	PDB:3s4wB	0.153	0.104	3.122E-3	1146	0.109	0.063	3s4wB.pdb.gz
13	PDB:8a2qB	0.141	0.100	5.871E-3	1084	0.112	0.068	8a2qB.pdb.gz
14	PDB:7kzvV	0.180	0.119	6.107E-3	1155	0.116	0.067	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:7pnt4	0.216	0.235	1.020E-2	589	0.086	0.097	7pnt4.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:4m57A	0.248	0.237	1.061E-2	702	0.092	0.087	4m57A.pdb.gz
17	PDB:3w3uA	0.245	0.175	1.148E-2	1030	0.103	0.066	3w3uA.pdb.gz
18	PDB:3w3zA	0.226	0.165	1.243E-2	1013	0.098	0.064	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
19	PDB:6vaeA	0.146	0.100	1.293E-2	1198	0.089	0.049	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
20	PDB:7wjiB	0.195	0.101	1.293E-2	1663	0.098	0.039	7wjiB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14CZ7	0.0	1357	662	1.000	1.000	FAKD3_HUMAN FAST kinase domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=2
2	D6RHY4	1.89e-176	503	244	0.369	1.000	D6RHY4_HUMAN FAST kinase domains 3 (Fragment) OS=Homo sapiens OX=9606 GN=FASTKD3 PE=1 SV=8
3	B4DU42	9.96e-24	108	642	0.202	0.209	B4DU42_HUMAN cDNA FLJ56153, highly similar to Homo sapiens transforming growth factor beta regulator 4 (TBRG4), transcript variant 1, mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
4	Q969Z0	1.51e-23	107	631	0.202	0.212	FAKD4_HUMAN FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1
5	Q14296	6.31e-22	102	549	0.131	0.158	FASTK_HUMAN Fas-activated serine/threonine kinase OS=Homo sapiens OX=9606 GN=FASTK PE=1 SV=1
6	Q9JIX9	6.76e-22	102	511	0.125	0.162	FASTK_MOUSE Fas-activated serine/threonine kinase OS=Mus musculus OX=10090 GN=Fastk PE=1 SV=1
7	Q91YM4	1.49e-19	95.5	630	0.202	0.213	FAKD4_MOUSE FAST kinase domain-containing protein 4 OS=Mus musculus OX=10090 GN=Tbrg4 PE=1 SV=1
8	Q53R41	1.59e-18	92.4	847	0.202	0.158	FAKD1_HUMAN FAST kinase domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD1 PE=1 SV=1
9	Q7L8L6	4.71e-10	65.1	764	0.100	0.086	FAKD5_HUMAN FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1
10	Q9NYY8	3.65e-08	58.9	710	0.057	0.054	FAKD2_HUMAN FAST kinase domain-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD2 PE=1 SV=1
11	Q922E6	6.92e-07	55.1	689	0.193	0.186	FAKD2_MOUSE FAST kinase domain-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Fastkd2 PE=2 SV=2
12	Q84MH1	6.82e-04	45.4	640	0.033	0.034	RAP_ORYSJ RAP domain-containing protein, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=AL1 PE=2 SV=1
13	Q8VZE7	0.001	44.7	671	0.041	0.040	RAP_ARATH RAP domain-containing protein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RAP PE=1 SV=1
14	Q8CHG3	0.76	35.4	1680	0.073	0.029	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
15	Q39214	2.8	33.5	926	0.024	0.017	RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana OX=3702 GN=RPM1 PE=1 SV=1
16	Q9VNB5	5.6	32.3	486	0.073	0.099	ORCO_DROME Odorant receptor coreceptor OS=Drosophila melanogaster OX=7227 GN=Orco PE=1 SV=2
17	K7UTH7	6.6	32.3	416	0.035	0.055	ERA1_MAIZE GTPase ERA1, chloroplastic OS=Zea mays OX=4577 GN=ERA1 PE=2 SV=1
18	Q06005	7.0	32.0	328	0.032	0.064	LIPB_YEAST Octanoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LIP2 PE=1 SV=1
19	P41695	7.7	32.3	1021	0.042	0.027	BUB1_YEAST Checkpoint serine/threonine-protein kinase BUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUB1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06743 FAST_1	5.2e-14	63.3	FAST kinase-like protein, subdomain 1
2	PF08368 FAST_2	8.1e-24	95.4	FAST kinase-like protein, subdomain 2
3	PF08168 NUC205	2.4e+02	12.6	NUC205 domain
4	PF08373 RAP	6.1e-14	63.1	RAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264669

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315397	0.767	Mitochondrial ribosomal protein S31
2	9606.ENSP00000405620	0.765	Putative ATP-dependent RNA helicase DHX30
3	9606.ENSP00000418008	0.759	Mitochondrial ribosomal protein S22
4	9606.ENSP00000402038	0.750	Protein MTO1 homolog, mitochondrial
5	9606.ENSP00000355889	0.740	Isoleucine--tRNA ligase, mitochondrial
6	9606.ENSP00000343657	0.733	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
7	9606.ENSP00000452762	0.708	Electron transfer flavoprotein subunit alpha, mitochondrial
8	9606.ENSP00000292478	0.696	Pentatricopeptide repeat-containing protein 1, mitochondrial
9	9606.ENSP00000360268	0.691	Delta-1-pyrroline-5-carboxylate synthase
10	9606.ENSP00000400646	0.674	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
11	9606.ENSP00000346173	0.657	Electron transfer flavoprotein subunit beta
12	9606.ENSP00000265594	0.652	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
13	9606.ENSP00000260665	0.644	Leucine-rich PPR motif-containing protein, mitochondrial
14	9606.ENSP00000299518	0.622	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
15	9606.ENSP00000358060	0.610	Threonine--tRNA ligase, mitochondrial
16	9606.ENSP00000384949	0.596	Pyrroline-5-carboxylate reductase 1, mitochondrial
17	9606.ENSP00000419325	0.592	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
18	9606.ENSP00000400168	0.591	ATP5J2-PTCD1 readthrough
19	9606.ENSP00000236980	0.588	FAST kinase domain-containing protein 2, mitochondrial
20	9606.ENSP00000322439	0.582	Elongation factor Tu, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0006417	0.978	regulation of translation
GO:0062125	0.974	regulation of mitochondrial gene expression
GO:0031325	0.957	positive regulation of cellular metabolic process
GO:0065003	0.956	protein-containing complex assembly
GO:0051247	0.946	positive regulation of protein metabolic process
GO:0065008	0.945	regulation of biological quality
GO:0007005	0.944	mitochondrion organization
GO:0043488	0.940	regulation of mRNA stability
GO:0034250	0.937	positive regulation of amide metabolic process
GO:0010628	0.930	positive regulation of gene expression
GO:0045727	0.923	positive regulation of translation
GO:0033108	0.917	mitochondrial respiratory chain complex assembly
GO:0017004	0.896	cytochrome complex assembly
GO:0070129	0.872	regulation of mitochondrial translation
GO:0008535	0.738	respiratory chain complex IV assembly
GO:0033617	0.725	mitochondrial cytochrome c oxidase assembly
GO:0071704	0.717	organic substance metabolic process
GO:0044238	0.711	primary metabolic process
GO:0044237	0.711	cellular metabolic process
GO:0006807	0.639	nitrogen compound metabolic process
GO:0044528	0.465	regulation of mitochondrial mRNA stability
GO:0043170	0.366	macromolecule metabolic process
GO:0034641	0.320	cellular nitrogen compound metabolic process
GO:0006725	0.316	cellular aromatic compound metabolic process
GO:1901360	0.306	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005654	0.996	nucleoplasm
GO:0005759	0.879	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]