StarFunc result for job id Q14D04

User Input

>input (833 residues)
MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEI
CITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRGNKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTM
LLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLRLLHVAAKKKQLEVVQKCIPF
LIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIGERFPYLTGQMARIYGAVGHV
DEERARSCLTYLVSQLANMEHSFHHILLLEIKSITDTFSSILGPQSRDIFRMSNSFTAIA
KLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENEDHEKLQVKIQAFEDKINAGS
NTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLS
EIDPLGQGNDKLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASP
IEYQDKLYLHLKKNLSKVKAYAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCL
YSKSSFILISQEPQPWIQIMFLFQQSLFPEPLSIQSHSVQFLRALWEKTQAGGAHSFETA
MMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLIE
GKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQSVKAVAKKRR
DRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14D04	1.000	1.000	0.000	833	1.000	1.000	Q14D04.pdb.gz	MELT_HUMAN Ventricular zone-expressed PH domain-containing protein homolog 1 OS=Homo sapiens OX=9606 GN=VEPH1 PE=1 SV=1
2	AFDB:A2BID5	0.476	0.487	3.136E-72	813	0.593	0.608	A2BID5.pdb.gz	MELT_DANRE Ventricular zone-expressed PH domain-containing protein OS=Danio rerio OX=7955 GN=veph PE=2 SV=1
3	AFDB:Q9VS24	0.439	0.376	2.015E-43	994	0.349	0.293	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
4	AFDB:Q9UPM8	0.208	0.166	7.241E-6	1137	0.114	0.084	Q9UPM8.pdb.gz	AP4E1_HUMAN AP-4 complex subunit epsilon-1 OS=Homo sapiens OX=9606 GN=AP4E1 PE=1 SV=2
5	AFDB:F4I6B2	0.221	0.225	8.828E-6	811	0.119	0.122	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
6	AFDB:Q96UP3	0.173	0.120	5.053E-5	1400	0.094	0.056	Q96UP3.pdb.gz	RIF1_SCHPO Telomere length regulator protein rif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rif1 PE=1 SV=1
7	PDB:4tnmA	0.275	0.494	8.382E-5	407	0.065	0.133	4tnmA.pdb.gz
8	AFDB:Q9VAR0	0.197	0.196	1.533E-4	835	0.088	0.087	Q9VAR0.pdb.gz	Q9VAR0_DROME LD39455p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1951 PE=1 SV=1
9	PDB:6xu2A	0.198	0.158	1.852E-4	1091	0.072	0.055	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	PDB:5tbkA	0.263	0.462	2.865E-4	417	0.061	0.122	5tbkA.pdb.gz
11	PDB:6kbnC	0.275	0.416	2.865E-4	504	0.058	0.095	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
12	PDB:3w3uA	0.208	0.178	3.782E-4	1030	0.048	0.039	3w3uA.pdb.gz
13	PDB:4r0zA	0.257	0.353	4.094E-4	557	0.077	0.115	4r0zA.pdb.gz
14	AFDB:Q9DGN1	0.184	0.137	4.654E-4	1265	0.077	0.051	Q9DGN1.pdb.gz	STAG1_XENLA Cohesin subunit SA-1 OS=Xenopus laevis OX=8355 GN=stag1 PE=1 SV=1
15	PDB:1wa5B	0.268	0.430	4.798E-4	466	0.062	0.112	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
16	PDB:4jlqA	0.224	0.222	4.798E-4	840	0.076	0.075	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
17	PDB:7p3xB	0.221	0.279	8.033E-4	621	0.060	0.081	7p3xB.pdb.gz
18	PDB:2xwuB	0.233	0.216	8.358E-4	910	0.070	0.064	2xwuB.pdb.gz
19	AFDB:A0A0G2K8V3	0.109	0.069	9.501E-4	1613	0.084	0.043	A0A0G2K8V3.pdb.gz	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
20	AFDB:Q8IWE5	0.121	0.104	1.412E-3	1019	0.096	0.079	Q8IWE5.pdb.gz	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BID5	0.0	971	813	0.599	0.614	MELT_DANRE Ventricular zone-expressed PH domain-containing protein OS=Danio rerio OX=7955 GN=veph PE=2 SV=1
2	Q14D04	0.0	1731	833	1.000	1.000	MELT_HUMAN Ventricular zone-expressed PH domain-containing protein homolog 1 OS=Homo sapiens OX=9606 GN=VEPH1 PE=1 SV=1
3	Q9VS24	9.87e-72	256	994	0.164	0.138	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
4	Q9ST43	0.001	42.4	145	0.041	0.234	PH1_ARATH Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PH1 PE=2 SV=2
5	Q3UGZ4	0.004	43.5	2388	0.042	0.015	Q3UGZ4_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
6	Q68FG2	0.004	43.5	2388	0.042	0.015	Q68FG2_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn2 PE=1 SV=1
7	Q68FM2	0.005	43.1	853	0.043	0.042	Q68FM2_MOUSE Spnb3 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
8	Q6A087	0.005	43.1	1972	0.042	0.018	Q6A087_MOUSE MKIAA0302 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
9	Q80ZK2	0.005	43.1	808	0.043	0.045	Q80ZK2_MOUSE Spnb3 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
10	Q15057	0.014	41.6	778	0.031	0.033	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
11	Q5FVC7	0.019	41.2	770	0.031	0.034	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
12	Q6ZQK5	0.021	40.8	770	0.031	0.034	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
13	Q15027	0.032	40.4	740	0.032	0.036	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
14	Q9VMI6	0.049	39.3	296	0.037	0.105	Q9VMI6_DROME Inositol phosphatase interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=IPIP PE=4 SV=1
15	Q96P48	0.069	39.3	1450	0.019	0.011	ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=3
16	Q8T0R1	0.070	39.3	767	0.036	0.039	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
17	Q9VCQ6	0.076	39.3	828	0.036	0.036	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
18	E7EU13	0.081	39.3	1194	0.019	0.013	E7EU13_HUMAN ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Homo sapiens OX=9606 GN=ARAP1 PE=1 SV=1
19	Q8IVF5	0.085	39.3	1701	0.037	0.018	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
20	Q75JH9	0.096	38.9	1503	0.029	0.016	Q75JH9_DICDI Actin binding protein OS=Dictyostelium discoideum OX=44689 GN=enlA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.5e-09	49.6	PH domain
2	PF15413 PH_11	0.81	21.6	Pleckstrin homology domain
3	PF14593 PH_3	1.6e+02	13.7	PH domain
4	PF15410 PH_9	23	16.6	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354919

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359848	0.726	GPI-anchor transamidase
2	9606.ENSP00000364133	0.712	TGF-beta receptor type-1
3	9606.ENSP00000249363	0.677	Leucine-rich repeat-containing protein 4
4	9606.ENSP00000403397	0.672	Palmitoyltransferase ZDHHC17
5	9606.ENSP00000296506	0.592	Scrapie-responsive protein 1
6	9606.ENSP00000371693	0.582	Tumor necrosis factor receptor superfamily member 19
7	9606.ENSP00000444935	0.567	Platelet-activating factor acetylhydrolase IB subunit gamma
8	9606.ENSP00000263640	0.513	Activin receptor type-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048523	0.983	negative regulation of cellular process
GO:0090092	0.958	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1902531	0.956	regulation of intracellular signal transduction
GO:0009968	0.955	negative regulation of signal transduction
GO:1903844	0.919	regulation of cellular response to transforming growth factor beta stimulus
GO:0090101	0.859	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030512	0.784	negative regulation of transforming growth factor beta receptor signaling pathway
GO:1902532	0.498	negative regulation of intracellular signal transduction
GO:0009987	0.350	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0005622	0.977	intracellular anatomical structure
GO:0005737	0.922	cytoplasm
GO:0043226	0.918	organelle
GO:0043229	0.714	intracellular organelle
GO:0043231	0.677	intracellular membrane-bounded organelle
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]