StarFunc result for job id Q15007

User Input

>input (396 residues)
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF
FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI
AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ
QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE
DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH
DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15007	1.000	1.000	2.515E-55	396	1.000	1.000	Q15007.pdb.gz	FL2D_HUMAN Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2
2	AFDB:Q7SXL7	0.284	0.266	1.372E-40	423	0.770	0.721	Q7SXL7.pdb.gz	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1
3	PDB:7vf2C	0.176	0.344	6.455E-19	184	0.462	0.995	7vf2C.pdb.gz
4	AFDB:Q9Y091	0.252	0.197	7.219E-14	536	0.346	0.256	Q9Y091.pdb.gz	FL2D_DROME Pre-mRNA-splicing regulator female-lethal(2)D OS=Drosophila melanogaster OX=7227 GN=fl(2)d PE=1 SV=2
5	AFDB:Q9ZSZ8	0.218	0.254	2.537E-6	330	0.187	0.224	Q9ZSZ8.pdb.gz	FIP37_ARATH FKBP12-interacting protein of 37 kDa OS=Arabidopsis thaliana OX=3702 GN=FIP37 PE=1 SV=1
6	AFDB:Q9P2B4	0.179	0.119	2.755E-5	639	0.184	0.114	Q9P2B4.pdb.gz	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
7	AFDB:Q9N5K3	0.178	0.125	1.513E-4	605	0.172	0.112	Q9N5K3.pdb.gz	SYP4_CAEEL Synaptonemal complex protein 4 OS=Caenorhabditis elegans OX=6239 GN=syp-4 PE=1 SV=1
8	AFDB:Q14152	0.175	0.063	2.277E-4	1382	0.149	0.043	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
9	AFDB:O43068	0.172	0.165	4.501E-4	421	0.162	0.152	O43068.pdb.gz	MDE4_SCHPO Monopolin complex subunit mde4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mde4 PE=1 SV=1
10	AFDB:Q9Y2D8	0.190	0.126	5.158E-4	614	0.157	0.101	Q9Y2D8.pdb.gz	ADIP_HUMAN Afadin- and alpha-actinin-binding protein OS=Homo sapiens OX=9606 GN=SSX2IP PE=1 SV=3
11	AFDB:Q6NRG6	0.224	0.138	8.311E-4	668	0.162	0.096	Q6NRG6.pdb.gz	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
12	PDB:5n9jG	0.120	0.249	2.835	163	0.048	0.117	5n9jG.pdb.gz
13	PDB:6wgeB	0.107	0.089	3.986	490	0.098	0.080	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
14	PDB:4ypoA	0.112	0.130	5.235	325	0.043	0.052	4ypoA.pdb.gz	Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
15	PDB:5mqfL	0.112	0.125	6.875	336	0.119	0.140	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
16	PDB:6sqwA	0.050	0.133	8.434	114	0.025	0.088	6sqwA.pdb.gz	The First Structure of an Active Mammalian dCTPase and its Complexes With Substrate Analogs and Products.
17	PDB:7rroA1	0.115	0.115	8.434	396	0.088	0.088	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7sqkA	0.132	0.173	9.666	278	0.101	0.144	7sqkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15007	0.0	809	396	1.000	1.000	FL2D_HUMAN Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2
2	Q7SXL7	0.0	585	423	0.775	0.726	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1
3	Q9ER69	0.0	747	396	0.965	0.965	FL2D_MOUSE Pre-mRNA-splicing regulator WTAP OS=Mus musculus OX=10090 GN=Wtap PE=1 SV=3
4	Q9Y091	4.85e-66	221	536	0.270	0.200	FL2D_DROME Pre-mRNA-splicing regulator female-lethal(2)D OS=Drosophila melanogaster OX=7227 GN=fl(2)d PE=1 SV=2
5	Q9ZSZ8	2.63e-30	120	330	0.179	0.215	FIP37_ARATH FKBP12-interacting protein of 37 kDa OS=Arabidopsis thaliana OX=3702 GN=FIP37 PE=1 SV=1
6	P38236	0.16	36.6	366	0.109	0.117	FL2D_YEAST Protein MUM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MUM2 PE=1 SV=1
7	A0A0A0MRF6	1.4	33.9	3931	0.076	0.008	A0A0A0MRF6_HUMAN A-kinase anchoring protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=2
8	Q99996	1.5	33.9	3907	0.076	0.008	AKAP9_HUMAN A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4
9	F1R8W3	5.0	31.6	488	0.088	0.072	F1R8W3_DANRE Desmin a OS=Danio rerio OX=7955 GN=cb290 PE=1 SV=1
10	F1R8W4	5.6	31.6	473	0.088	0.074	F1R8W4_DANRE Desmin a OS=Danio rerio OX=7955 GN=cb290 PE=1 SV=1
11	Q16352	7.8	31.2	499	0.098	0.078	AINX_HUMAN Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2
12	Q01649	9.0	31.2	594	0.043	0.029	CIK1_YEAST Spindle pole body-associated protein CIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	1e+02	14.4	Afadin- and alpha -actinin-Binding
2	PF20072 DUF6468	2.1e+02	13.5	Domain of unknown function (DUF6468)
3	PF15120 SPACA9	18	16.6	Sperm acrosome-associated protein 9
4	PF17098 Wtap	1.8e-55	198.7	WTAP/Mum2p family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282007	0.999	Zinc finger CCCH domain-containing protein 13
2	9606.ENSP00000297591	0.999	Protein virilizer homolog
3	9606.ENSP00000298717	0.999	N6-adenosine-methyltransferase catalytic subunit
4	9606.ENSP00000358799	0.999	Putative RNA-binding protein 15
5	9606.ENSP00000373474	0.999	N6-adenosine-methyltransferase non-catalytic subunit
6	9606.ENSP00000401277	0.999	E3 ubiquitin-protein ligase Hakai
7	9606.ENSP00000454545	0.997	Putative RNA-binding protein 15B
8	9606.ENSP00000331327	0.993	Wilms tumor protein
9	9606.ENSP00000382091	0.951	RNA demethylase ALKBH5
10	9606.ENSP00000364289	0.934	Nuclear cap-binding protein subunit 1
11	9606.ENSP00000339245	0.917	YTH domain-containing protein 1
12	9606.ENSP00000326806	0.916	Nuclear cap-binding protein subunit 2
13	9606.ENSP00000370625	0.916	DNA-directed RNA polymerase II subunit RPB2
14	9606.ENSP00000377969	0.909	General transcription factor IIF subunit 1
15	9606.ENSP00000323348	0.907	E3 ubiquitin-protein ligase ZNF645
16	9606.ENSP00000340823	0.907	General transcription factor IIF subunit 2
17	9606.ENSP00000480158	0.906	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000301788	0.905	DNA-directed RNA polymerase II subunit RPB7
19	9606.ENSP00000221859	0.904	DNA-directed RNA polymerase II subunit RPB9
20	9606.ENSP00000324124	0.904	DNA-directed RNA polymerases I, II, and III subunit RPABC5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0010468	0.991	regulation of gene expression
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0016071	0.987	mRNA metabolic process
GO:0051252	0.984	regulation of RNA metabolic process
GO:0044260	0.980	cellular macromolecule metabolic process
GO:0009451	0.965	RNA modification
GO:1903311	0.963	regulation of mRNA metabolic process
GO:0043414	0.961	macromolecule methylation
GO:0001510	0.953	RNA methylation
GO:0016556	0.951	mRNA modification
GO:0000381	0.935	regulation of alternative mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0036396	0.998	RNA N6-methyladenosine methyltransferase complex
GO:0016020	0.978	membrane
GO:0012505	0.976	endomembrane system
GO:0005737	0.971	cytoplasm
GO:0016604	0.742	nuclear body
GO:0016607	0.696	nuclear speck
GO:0031090	0.620	organelle membrane
GO:0031967	0.450	organelle envelope
GO:0005635	0.433	nuclear envelope
GO:0005829	0.408	cytosol
GO:0031965	0.341	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]