StarFunc result for job id Q15008

User Input

>input (389 residues)
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKS
LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15008	1.000	1.000	1.779E-49	389	1.000	1.000	Q15008.pdb.gz	PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1
2	AFDB:Q9V3G7	0.949	0.949	1.565E-39	389	0.702	0.702	Q9V3G7.pdb.gz	PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster OX=7227 GN=Rpn7 PE=2 SV=1
3	PDB:5l4kR	0.911	0.911	1.902E-39	389	1.000	1.000	5l4kR.pdb.gz
4	AFDB:Q93Y35	0.909	0.913	3.094E-31	387	0.527	0.530	Q93Y35.pdb.gz	PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN7 PE=1 SV=1
5	AFDB:Q10335	0.857	0.817	5.097E-26	409	0.429	0.408	Q10335.pdb.gz	RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn7 PE=2 SV=1
6	AFDB:Q381I3	0.882	0.861	8.064E-26	399	0.375	0.366	Q381I3.pdb.gz	Q381I3_TRYB2 Proteasome regulatory non-ATP-ase subunit 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7690 PE=4 SV=1
7	AFDB:Q06103	0.913	0.830	6.433E-24	429	0.380	0.345	Q06103.pdb.gz	RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN7 PE=1 SV=3
8	PDB:3jckD	0.897	0.909	3.748E-21	384	0.375	0.380	3jckD.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
9	PDB:6fvtR	0.871	0.838	1.613E-20	405	0.378	0.363	6fvtR.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
10	AFDB:A8K070	0.796	0.602	3.956E-16	526	0.221	0.163	A8K070.pdb.gz	A8K070_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
11	AFDB:Q54QX3	0.795	0.683	4.125E-16	458	0.203	0.172	Q54QX3.pdb.gz	CSN1_DICDI COP9 signalosome complex subunit 1 OS=Dictyostelium discoideum OX=44689 GN=csn1 PE=1 SV=1
12	AFDB:P45432	0.773	0.689	8.309E-15	441	0.206	0.181	P45432.pdb.gz	CSN1_ARATH COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CSN1 PE=1 SV=2
13	AFDB:Q9VVU5	0.784	0.593	1.209E-14	525	0.213	0.158	Q9VVU5.pdb.gz	CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster OX=7227 GN=CSN1b PE=2 SV=1
14	PDB:6r7iA	0.750	0.691	1.543E-10	426	0.219	0.200	6r7iA.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
15	PDB:3txmA	0.520	0.563	1.442E-7	353	0.139	0.153	3txmA.pdb.gz
16	PDB:5mpbQ	0.440	0.404	1.503E-7	434	0.123	0.111	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:6r7nB	0.553	0.494	2.013E-7	443	0.131	0.115	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
18	PDB:5mpbP	0.417	0.380	1.024E-6	440	0.162	0.143	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:5l4kO	0.434	0.448	7.581E-6	376	0.121	0.125	5l4kO.pdb.gz
20	PDB:5gjr6	0.475	0.444	8.241E-6	421	0.131	0.121	5gjr6.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15008	0.0	800	389	1.000	1.000	PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens OX=9606 GN=PSMD6 PE=1 SV=1
2	Q7ZWE5	0.0	734	386	0.923	0.930	Q7ZWE5_DANRE 26S proteasome non-ATPase regulatory subunit 6 OS=Danio rerio OX=7955 GN=zgc:56471 PE=1 SV=1
3	Q99JI4	0.0	790	389	0.979	0.979	PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus OX=10090 GN=Psmd6 PE=1 SV=1
4	Q9V3G7	0.0	578	389	0.702	0.702	PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster OX=7227 GN=Rpn7 PE=2 SV=1
5	Q93Y35	7.65e-150	431	387	0.527	0.530	PSMD6_ARATH 26S proteasome non-ATPase regulatory subunit 6 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN7 PE=1 SV=1
6	Q10335	8.82e-105	317	409	0.434	0.413	RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn7 PE=2 SV=1
7	Q381I3	5.60e-87	271	399	0.357	0.348	Q381I3_TRYB2 Proteasome regulatory non-ATP-ase subunit 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7690 PE=4 SV=1
8	Q8WRU4	3.15e-86	269	399	0.357	0.348	Q8WRU4_9TRYP Proteasome regulatory non-ATP-ase subunit 7 OS=Trypanosoma brucei OX=5691 GN=Rpn7 PE=2 SV=1
9	Q06103	7.58e-84	263	429	0.380	0.345	RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN7 PE=1 SV=3
10	Q54QX3	4.94e-22	99.4	458	0.198	0.168	CSN1_DICDI COP9 signalosome complex subunit 1 OS=Dictyostelium discoideum OX=44689 GN=csn1 PE=1 SV=1
11	Q99LD4	9.44e-20	92.8	471	0.229	0.189	CSN1_MOUSE COP9 signalosome complex subunit 1 OS=Mus musculus OX=10090 GN=Gps1 PE=1 SV=1
12	P97834	1.26e-19	92.4	471	0.229	0.189	CSN1_RAT COP9 signalosome complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Gps1 PE=1 SV=1
13	A0A096LP07	8.35e-19	90.1	486	0.180	0.144	A0A096LP07_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
14	A0A096LPJ3	8.71e-19	90.1	490	0.180	0.143	A0A096LPJ3_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
15	A8K070	1.02e-18	90.1	526	0.180	0.133	A8K070_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
16	C9JFE4	1.25e-18	89.4	471	0.177	0.146	C9JFE4_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=2
17	Q13098	1.39e-18	89.4	491	0.177	0.141	CSN1_HUMAN COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4
18	Q9VVU5	3.49e-17	85.5	525	0.183	0.135	CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster OX=7227 GN=CSN1b PE=2 SV=1
19	P45432	1.63e-14	77.0	441	0.131	0.116	CSN1_ARATH COP9 signalosome complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CSN1 PE=1 SV=2
20	O94308	2.20e-11	67.4	422	0.201	0.185	CSN1_SCHPO COP9 signalosome complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=csn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01399 PCI	2.8e-13	61.6	PCI domain
2	PF10602 RPN7	3.4e-60	214.2	26S proteasome subunit RPN7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000015370

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000001012	0.999	Proteasome (prosome, macropain) subunit, beta type, 4
2	9601.ENSPPYP00000001793	0.999	Proteasome (prosome, macropain) subunit, beta type, 2
3	9601.ENSPPYP00000003979	0.999	Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP- dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no lon [...]
4	9601.ENSPPYP00000006652	0.999	Proteasome (prosome, macropain) subunit, alpha type, 3
5	9601.ENSPPYP00000007603	0.999	Proteasome (prosome, macropain) subunit, alpha type, 4
6	9601.ENSPPYP00000009557	0.999	Proteasome (prosome, macropain) subunit, beta type, 3
7	9601.ENSPPYP00000024301	0.999	Proteasome endopeptidase complex
8	9601.ENSPPYP00000006612	0.998	Proteasome (prosome, macropain) 26S subunit, ATPase, 6
9	9601.ENSPPYP00000008832	0.998	Proteasome (prosome, macropain) subunit, beta type, 6
10	9601.ENSPPYP00000009176	0.998	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
11	9601.ENSPPYP00000009620	0.998	Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair
12	9601.ENSPPYP00000011174	0.998	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
13	9601.ENSPPYP00000014374	0.998	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
14	9601.ENSPPYP00000020045	0.998	Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. PSMC2 belongs to the heterohexameric ring of AAA (ATPases associated with diverse cellular activities) protein [...]
15	9601.ENSPPYP00000021958	0.998	Proteasome (prosome, macropain) subunit, beta type, 7
16	9601.ENSPPYP00000022356	0.998	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
17	9601.ENSPPYP00000024628	0.998	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
18	9601.ENSPPYP00000003790	0.997	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
19	9601.ENSPPYP00000011119	0.997	Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair
20	9601.ENSPPYP00000012509	0.997	Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP- dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no lon [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051603	0.985	proteolysis involved in protein catabolic process
GO:0043632	0.983	modification-dependent macromolecule catabolic process
GO:0006511	0.941	ubiquitin-dependent protein catabolic process
GO:0048856	0.871	anatomical structure development
GO:0043161	0.714	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0032501	0.313	multicellular organismal process
GO:0007275	0.301	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0000502	0.997	proteasome complex
GO:0005829	0.996	cytosol
GO:0005634	0.988	nucleus
GO:0005654	0.973	nucleoplasm
GO:0022624	0.758	proteasome accessory complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]