StarFunc result for job id Q15011

User Input

>input (391 residues)
MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG
KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS
SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA
NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM
YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE
QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15011	1.000	1.000	1.879E-67	391	1.000	1.000	Q15011.pdb.gz	HERP1_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1
2	AFDB:Q9ESS9	0.565	0.565	2.185E-56	391	0.872	0.872	Q9ESS9.pdb.gz
3	AFDB:Q9BSE4	0.237	0.229	5.452E-31	406	0.404	0.389	Q9BSE4.pdb.gz	HERP2_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Homo sapiens OX=9606 GN=HERPUD2 PE=1 SV=2
4	AFDB:Q9JJC9	0.327	0.318	1.043E-30	404	0.407	0.394	Q9JJC9.pdb.gz	HERP2_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Mus musculus OX=10090 GN=Herpud2 PE=2 SV=1
5	AFDB:Q9VLW9	0.267	0.231	1.974E-20	465	0.274	0.230	Q9VLW9.pdb.gz	Q9VLW9_DROME Homocysteine-induced endoplasmic reticulum protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Herp PE=1 SV=1
6	AFDB:A2QB71	0.228	0.149	3.502E-10	619	0.199	0.126	A2QB71.pdb.gz	A2QB71_ASPNC Contig An01c0450, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g14100 PE=4 SV=1
7	AFDB:D4AA63	0.217	0.137	4.683E-9	638	0.205	0.125	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
8	AFDB:Q9UHD9	0.200	0.132	6.070E-9	624	0.199	0.125	Q9UHD9.pdb.gz	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
9	AFDB:A0A1D8PGE3	0.238	0.225	4.529E-8	416	0.136	0.127	A0A1D8PGE3.pdb.gz	A0A1D8PGE3_CANAL UV excision repair protein RAD23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD23 PE=3 SV=1
10	AFDB:A0A024R7G8	0.188	0.201	1.364E-7	363	0.148	0.160	A0A024R7G8.pdb.gz
11	PDB:7rbsB	0.188	0.447	6.400E-7	157	0.043	0.108	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:3dbhI	0.190	0.768	9.444E-7	86	0.059	0.267	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
13	PDB:3ai5A	0.174	0.225	1.008E-6	299	0.056	0.074	3ai5A.pdb.gz
14	PDB:4x57B	0.198	0.759	3.685E-6	93	0.043	0.183	4x57B.pdb.gz
15	PDB:3plvA	0.174	0.784	7.519E-6	80	0.043	0.212	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
16	PDB:6mdhA	0.182	0.458	1.040E-5	149	0.031	0.081	6mdhA.pdb.gz
17	PDB:6yvaC	0.186	0.451	1.263E-5	155	0.046	0.116	6yvaC.pdb.gz
18	PDB:4pyuA	0.180	0.850	2.577E-5	76	0.028	0.145	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:6ef3u	0.177	0.821	4.329E-5	75	0.054	0.280	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
20	PDB:5xqmA	0.173	0.655	8.833E-5	90	0.033	0.144	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6B3C5	0.0	679	489	0.872	0.697	A0A8I6B3C5_RAT Homocysteine inducible ER protein with ubiquitin like domain 1 OS=Rattus norvegicus OX=10116 GN=Herpud1 PE=1 SV=1
2	F7F5G8	0.0	589	354	0.760	0.839	F7F5G8_RAT Homocysteine inducible ER protein with ubiquitin like domain 1 OS=Rattus norvegicus OX=10116 GN=Herpud1 PE=1 SV=1
3	Q15011	0.0	805	391	1.000	1.000	HERP1_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1
4	Q9JJK5	0.0	689	391	0.887	0.887	HERP1_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Mus musculus OX=10090 GN=Herpud1 PE=1 SV=1
5	Q9BSE4	2.10e-82	259	406	0.417	0.401	HERP2_HUMAN Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Homo sapiens OX=9606 GN=HERPUD2 PE=1 SV=2
6	Q9JJC9	5.96e-79	250	404	0.427	0.413	HERP2_MOUSE Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein OS=Mus musculus OX=10090 GN=Herpud2 PE=2 SV=1
7	Q9VLW9	6.56e-16	81.3	465	0.123	0.103	Q9VLW9_DROME Homocysteine-induced endoplasmic reticulum protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Herp PE=1 SV=1
8	Q8SZY6	3.78e-05	47.4	258	0.054	0.081	Q8SZY6_DROME LD48048p OS=Drosophila melanogaster OX=7227 GN=Herp PE=2 SV=1
9	A2QB71	0.010	40.4	619	0.077	0.048	A2QB71_ASPNC Contig An01c0450, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g14100 PE=4 SV=1
10	Q9NIF3	0.10	37.4	523	0.041	0.031	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
11	G5EFF7	0.12	37.0	502	0.069	0.054	UBQL_CAEEL Ubiquilin OS=Caenorhabditis elegans OX=6239 GN=ubql-1 PE=2 SV=1
12	Q9ZPY9	0.38	35.4	566	0.051	0.035	P4KG4_ARATH Phosphatidylinositol 4-kinase gamma 4 OS=Arabidopsis thaliana OX=3702 GN=PI4KG4 PE=1 SV=1
13	Q9SGW8	0.50	35.0	550	0.084	0.060	P4KG2_ARATH Phosphatidylinositol 4-kinase gamma 2 OS=Arabidopsis thaliana OX=3702 GN=PI4KG2 PE=1 SV=2
14	Q9FNF8	0.61	34.7	574	0.077	0.052	P4KG3_ARATH Phosphatidylinositol 4-kinase gamma 3 OS=Arabidopsis thaliana OX=3702 GN=PI4KG3 PE=2 SV=1
15	Q10169	0.75	34.3	354	0.061	0.068	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
16	Q5H8C1	0.92	34.3	2179	0.066	0.012	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
17	A2Q831	1.3	32.0	128	0.046	0.141	A2Q831_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g02880 PE=3 SV=1
18	P0CH07	1.4	32.0	128	0.046	0.141	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
19	P0CH08	1.4	32.0	128	0.046	0.141	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
20	P0CH09	1.4	32.0	128	0.046	0.141	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10302 Dsc3_N	4.2e+02	12.9	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
2	PF00240 ubiquitin	3.2e-09	47.7	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366395	0.968	E3 ubiquitin-protein ligase synoviolin
2	9606.ENSP00000336790	0.951	Cyclic AMP-dependent transcription factor ATF-4
3	9606.ENSP00000290649	0.906	E3 ubiquitin-protein ligase AMFR
4	9606.ENSP00000249356	0.770	DnaJ homolog subfamily B member 9
5	9606.ENSP00000466134	0.766	Glucosidase 2 subunit beta
6	9606.ENSP00000256497	0.761	ER degradation-enhancing alpha-mannosidase-like protein 1
7	9606.ENSP00000337053	0.754	Protein sel-1 homolog 1
8	9606.ENSP00000300289	0.738	Protein disulfide-isomerase A3
9	9606.ENSP00000216037	0.737	X-box-binding protein 1
10	9606.ENSP00000324173	0.734	78 kDa glucose-regulated protein
11	9606.ENSP00000259512	0.719	Derlin-1
12	9606.ENSP00000473631	0.712	DnaJ homolog subfamily C member 3
13	9606.ENSP00000009530	0.698	HLA class II histocompatibility antigen gamma chain
14	9606.ENSP00000383938	0.696	Cysteine rich with EGF like domains 2
15	9606.ENSP00000158771	0.686	Derlin-2
16	9606.ENSP00000448665	0.675	DNA damage-inducible transcript 3 protein
17	9606.ENSP00000338019	0.631	DnaJ homolog subfamily B member 2
18	9606.ENSP00000356919	0.626	Cyclic AMP-dependent transcription factor ATF-6 alpha
19	9606.ENSP00000326366	0.608	Presenilin-1
20	9606.ENSP00000286091	0.607	Protein disulfide-isomerase A4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	0.998	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0042221	0.978	response to chemical
GO:0033554	0.977	cellular response to stress
GO:0071704	0.974	organic substance metabolic process
GO:0034976	0.971	response to endoplasmic reticulum stress
GO:0030162	0.968	regulation of proteolysis
GO:0043067	0.967	regulation of programmed cell death
GO:0034620	0.965	cellular response to unfolded protein
GO:0048523	0.963	negative regulation of cellular process
GO:0044238	0.962	primary metabolic process
GO:0042981	0.957	regulation of apoptotic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0030968	0.951	endoplasmic reticulum unfolded protein response
GO:0044237	0.947	cellular metabolic process
GO:0006807	0.915	nitrogen compound metabolic process
GO:0080135	0.914	regulation of cellular response to stress
GO:0065009	0.911	regulation of molecular function
GO:0043161	0.908	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:2001233	0.898	regulation of apoptotic signaling pathway
GO:0010605	0.885	negative regulation of macromolecule metabolic process
GO:0031329	0.884	regulation of cellular catabolic process
GO:1905897	0.883	regulation of response to endoplasmic reticulum stress
GO:0044092	0.882	negative regulation of molecular function
GO:0043069	0.882	negative regulation of programmed cell death
GO:2001242	0.874	regulation of intrinsic apoptotic signaling pathway
GO:0051248	0.873	negative regulation of protein metabolic process
GO:0043066	0.870	negative regulation of apoptotic process
GO:0006886	0.858	intracellular protein transport
GO:0042176	0.836	regulation of protein catabolic process
GO:0050790	0.834	regulation of catalytic activity
GO:0048585	0.834	negative regulation of response to stimulus
GO:0048518	0.833	positive regulation of biological process
GO:0010243	0.829	response to organonitrogen compound
GO:0009968	0.792	negative regulation of signal transduction
GO:0036503	0.764	ERAD pathway
GO:0051247	0.755	positive regulation of protein metabolic process
GO:0048522	0.740	positive regulation of cellular process
GO:2001243	0.736	negative regulation of intrinsic apoptotic signaling pathway
GO:1903573	0.701	negative regulation of response to endoplasmic reticulum stress
GO:0019725	0.690	cellular homeostasis
GO:0045861	0.686	negative regulation of proteolysis
GO:0006874	0.670	intracellular calcium ion homeostasis
GO:0052547	0.664	regulation of peptidase activity
GO:0043086	0.648	negative regulation of catalytic activity
GO:0043281	0.637	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051346	0.635	negative regulation of hydrolase activity
GO:0043154	0.627	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0030433	0.522	ubiquitin-dependent ERAD pathway
GO:0031325	0.501	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0032991	0.548	protein-containing complex
GO:0070013	0.520	intracellular organelle lumen
GO:0016234	0.466	inclusion body
GO:1990037	0.388	Lewy body core

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]